Advanced Search (OLGA)

Gene: Rax (retina and anterior neural fold homeobox) Rattus norvegicus

Analyze

Symbol:

Rax

Name:

retina and anterior neural fold homeobox

RGD ID:

620371

Description:

Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in positive regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including camera-type eye development; hypothalamus development; and limb development. Predicted to be located in nucleus. Human ortholog(s) of this gene implicated in isolated microphthalmia 3. Orthologous to human RAX (retina and anterior neural fold homeobox); INTERACTS WITH 1,2-dimethylhydrazine; 2,3,7,8-tetrachlorodibenzodioxine; acrylamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

retina and anterior neural fold homeobox protein; retinal homeobox protein Rx; retinal homeobox transcription factor Rx/rax; Rx

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RAX (retina and anterior neural fold homeobox)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther
Mus musculus (house mouse):	Rax (retina and anterior neural fold homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rax (retina and anterior neural fold homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RAX (retina and anterior neural fold homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RAX (retina and anterior neural fold homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rax (retina and anterior neural fold homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RAX (retina and anterior neural fold homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RAX (retina and anterior neural fold homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rax (retina and anterior neural fold homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Rax (retina and anterior neural fold homeobox)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Rax (retina and anterior neural fold homeobox)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	RAX (retina and anterior neural fold homeobox)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rx3 (retinal homeobox gene 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rx3 (retinal homeobox gene 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ceh-8	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Rx	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	rax	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	61,733,322 - 61,737,444 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	18	61,733,322 - 61,737,444 (-)	Ensembl				GRCr8
mRatBN7.2	18	59,463,347 - 59,467,469 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	59,463,737 - 59,467,431 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	18	61,557,510 - 61,561,206 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	62,256,193 - 62,259,889 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	60,084,163 - 60,087,857 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	61,638,352 - 61,642,056 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	61,638,352 - 61,642,056 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	18	60,835,143 - 60,838,847 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	18	62,567,485 - 62,571,191 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	18	57,585,618 - 57,589,312 (-)	NCBI		Celera
RGSC_v3.1	18	62,640,685 - 62,644,392 (+)	NCBI
Cytogenetic Map	18	q12.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Anophthalmia (ISO)

Craniofacial Abnormalities (ISO)

genetic disease (ISO)

isolated microphthalmia 3 (ISO)

melanoma (ISO)

syndromic microphthalmia 5 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

arsenite(3-) (ISO)

belinostat (ISO)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

chlorpyrifos (ISO)

copper atom (EXP)

copper(0) (EXP)

decabromodiphenyl ether (EXP)

diazinon (ISO)

dorsomorphin (ISO)

entinostat (ISO)

fenvalerate (EXP)

lead diacetate (ISO)

methylmercury chloride (ISO)

panobinostat (ISO)

paracetamol (ISO)

phenylmercury acetate (ISO)

propanal (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

brain development (ISO)

camera-type eye development (ISO)

DNA-templated transcription (IEA)

hypothalamus development (ISO)

limb development (ISO)

pattern specification process (ISO)

positive regulation of transcription by RNA polymerase II (IEA,ISO)

regulation of DNA-templated transcription (IEA)

regulation of transcription by RNA polymerase II (IBA)

Cellular Component

nucleus (IEA)

Molecular Function

DNA binding (IEA)

DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IEA)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IEA,ISO)

sequence-specific double-stranded DNA binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	rax, Hes1, and notch1 promote the formation of Muller glia by postnatal retinal progenitor cells.	Furukawa T, etal., Neuron 2000 May;26(2):383-94.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:640224	PMID:925203	PMID:10625658	PMID:11105055	PMID:11668677	PMID:13970081	PMID:13970082	PMID:15789424	PMID:17247120	PMID:21749377	PMID:21897745

Genomics

Comparative Map Data

Rax
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	61,733,322 - 61,737,444 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	18	61,733,322 - 61,737,444 (-)	Ensembl				GRCr8
mRatBN7.2	18	59,463,347 - 59,467,469 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	59,463,737 - 59,467,431 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	18	61,557,510 - 61,561,206 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	62,256,193 - 62,259,889 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	60,084,163 - 60,087,857 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	61,638,352 - 61,642,056 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	61,638,352 - 61,642,056 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	18	60,835,143 - 60,838,847 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	18	62,567,485 - 62,571,191 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	18	57,585,618 - 57,589,312 (-)	NCBI		Celera
RGSC_v3.1	18	62,640,685 - 62,644,392 (+)	NCBI
Cytogenetic Map	18	q12.1	NCBI

RAX
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	18	59,267,038 - 59,273,454 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	18	59,267,035 - 59,274,086 (-)	Ensembl			hg38	GRCh38
GRCh37	18	56,934,270 - 56,940,686 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	18	55,085,247 - 55,091,605 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	18	53,652,123 - 53,658,480 (-)	NCBI		Celera
Cytogenetic Map	18	q21.32	NCBI
HuRef	18	53,643,456 - 53,649,718 (-)	NCBI		HuRef
CHM1_1	18	56,929,439 - 56,935,862 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	18	59,468,558 - 59,474,973 (-)	NCBI		T2T-CHM13v2.0

Rax
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	66,067,710 - 66,072,160 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	66,061,348 - 66,072,858 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	18	65,934,639 - 65,939,089 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	65,928,277 - 65,939,787 (-)	Ensembl			mm10	GRCm38
MGSCv37	18	66,094,293 - 66,098,743 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	18	66,060,005 - 66,064,442 (-)	NCBI		MGSCv36	mm8
Celera	18	67,210,139 - 67,214,590 (-)	NCBI		Celera
Cytogenetic Map	18	E1	NCBI
cM Map	18	39.03	NCBI

Rax
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955402	43,410,404 - 43,414,306 (-)	Ensembl
ChiLan1.0	NW_004955402	43,408,933 - 43,414,697 (-)	NCBI	ChiLan1.0	ChiLan1.0

RAX
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	17	76,813,222 - 76,819,634 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	18	62,505,836 - 62,512,248 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	18	52,664,243 - 52,669,177 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	18	55,990,984 - 55,995,469 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	18	55,990,984 - 55,995,469 (-)	Ensembl			panPan2	panpan1.1

RAX
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	16,940,671 - 16,945,127 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	16,940,658 - 16,943,633 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	17,915,783 - 17,920,202 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	16,817,416 - 16,821,898 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	16,817,416 - 16,821,898 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	16,853,025 - 16,857,444 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	16,773,789 - 16,778,200 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	17,035,324 - 17,039,744 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Rax
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404944	30,212,492 - 30,218,299 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936497	5,452,800 - 5,456,905 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936497	5,451,055 - 5,457,334 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RAX
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	161,678,955 - 161,683,060 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	1	161,679,154 - 161,683,486 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	179,257,056 - 179,260,894 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RAX
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	18	20,464,417 - 20,469,281 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	18	20,464,657 - 20,468,812 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666060	5,117,972 - 5,124,458 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rax
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624792	4,652,493 - 4,656,826 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624792	4,652,430 - 4,657,048 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Rax
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	15	65,326,543 - 65,330,369 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Rax
38 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	67
Count of miRNA genes:	62
Interacting mature miRNAs:	67
Transcripts:	ENSRNOT00000022784
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25071126	83910656	Rat
1331730	Scl27	Serum cholesterol level QTL 27	3.826		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	18	54490801	86134022	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	23494057	85487725	Rat
1331742	Bp228	Blood pressure QTL 228	3.88752		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	77371277	Rat
1300125	Rf26	Renal function QTL 26	3.2		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	18	53350521	68120379	Rat
631834	Sach3	Saccharin preference QTL 3	3.9	0.01	consumption behavior trait (VT:0002069)	calculated saccharin drink intake volume (CMO:0001600)	18	38575919	83575919	Rat
12904668	Bw188	Body weight QTL 188		0.03	body mass (VT:0001259)	body weight (CMO:0000012)	18	26822186	71822186	Rat
12904669	Cm125	Cardiac mass QTL 125		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	26822186	71822186	Rat
12904670	Cm126	Cardiac mass QTL 126		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	26822186	71822186	Rat
6893683	Bw110	Body weight QTL 110	2.7	0.002	body mass (VT:0001259)	body weight (CMO:0000012)	18	45620306	86134022	Rat
1331727	Bp237	Blood pressure QTL 237	3.053		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	63968306	Rat
12904677	Kidm72	Kidney mass QTL 72		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	26822186	71822186	Rat
9589041	Epfw12	Epididymal fat weight QTL 12	17.08	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	18	48915737	86134022	Rat
8694432	Bw165	Body weight QTL 165	3.81	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	48915737	86134022	Rat
12904673	Cm127	Cardiac mass QTL 127		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	26822186	71822186	Rat
12904675	Am19	Aortic mass QTL 19		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	26822186	71822186	Rat
70185	BpQTLcluster15	Blood pressure QTL cluster 15	4.61		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	18	53845175	61982387	Rat
1331774	Bp226	Blood pressure QTL 226	4.41065		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	77371277	Rat
9589816	Gluco68	Glucose level QTL 68	7.25	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	31990891	76990891	Rat
1331770	Bp234	Blood pressure QTL 234	3.807		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	45620306	86134022	Rat
61360	Eaey	Experimental allergic encephalomyelitis QTL y	3		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis duration (CMO:0001424)	18	49187226	62647720	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	12066482	85493247	Rat
2303120	Mamtr8	Mammary tumor resistance QTL 8		0.001	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	31610505	85493247	Rat
12880368	Bw187	Body weight QTL 187		0.045	body mass (VT:0001259)	body weight (CMO:0000012)	18	33379158	78379158	Rat
724542	Kidm2	Kidney mass QTL 2	2.6		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	18	61446853	86134022	Rat
61367	Iddm4	Insulin dependent diabetes mellitus QTL 4	2.33	0.0074	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	40462383	85462383	Rat
1359020	Ppulsi2	Prepulse inhibition QTL 2	2.71		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	18	54490801	76272247	Rat
2312600	Bp341	Blood pressure QTL 341		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	61600384	72538878	Rat
9590318	Scort22	Serum corticosterone level QTL 22	7.64	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	18	31990891	76990891	Rat
1331752	Bw27	Body weight QTL 27	2.963		body mass (VT:0001259)	body weight (CMO:0000012)	18	54490801	68120379	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	12066482	85493247	Rat
1331754	Bp230	Blood pressure QTL 230	4.61609		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	15642280	86134022	Rat
12904069	Cm123	Cardiac mass QTL 123		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	33379158	78379158	Rat
1331798	Bp224	Blood pressure QTL 224	3.53873		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	77371277	Rat
12904070	Cm124	Cardiac mass QTL 124		0.01	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	33379158	78379158	Rat
12904071	Am18	Aortic mass QTL 18		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	33379158	78379158	Rat
2303584	Gluco55	Glucose level QTL 55	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	18	50795212	86134022	Rat
2301413	Bp318	Blood pressure QTL 318		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	26822186	71822186	Rat
61383	Bp47	Blood pressure QTL 47	17.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	31522783	76522783	Rat
12904067	Cm122	Cardiac mass QTL 122		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	33379158	78379158	Rat
2301417	Bp319	Blood pressure QTL 319		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	33379158	78379158	Rat
12904073	Kidm71	Kidney mass QTL 71		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	33379158	78379158	Rat
738008	Hcar14	Hepatocarcinoma resistance QTL 14	4.3		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion number (CMO:0001462)	18	57825243	85493247	Rat
1331776	Bp225	Blood pressure QTL 225	2.829		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	31610505	77371277	Rat
631518	Bw11	Body weight QTL 11	2.8		body mass (VT:0001259)	body weight (CMO:0000012)	18	36121626	81121626	Rat
1641923	Colcr8	Colorectal carcinoma resistance QTL 8	3.1	0.0014	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	18	31990891	76990891	Rat
8694366	Abfw8	Abdominal fat weight QTL 8	6.38	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	18	48915737	86134022	Rat
631509	Sald2	Serum aldosterone level QTL 2	2.9		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	18	26415821	71415821	Rat
631274	Sprol1	Serum protein level QTL 1	5.3		blood total protein amount (VT:0005567)	serum total protein level (CMO:0000661)	18	31644508	79484311	Rat
1598832	Glom11	Glomerulus QTL 11	2.9		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	18	53266671	86134022	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19553532	85493247	Rat
8694378	Bw157	Body weight QTL 157	3.59	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	31990891	76990891	Rat
2303571	Bw92	Body weight QTL 92	3		body mass (VT:0001259)	body weight (CMO:0000012)	18	50795212	86134022	Rat
61429	Cia17	Collagen induced arthritis QTL 17	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	31610505	72538878	Rat
7411719	Strs5	Sensitivity to stroke QTL 5	9.4		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	18	52198059	68120379	Rat

Markers in Region

Rax

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	18	61,736,834 - 61,737,261 (+)	Marker Load Pipeline
Rnor_6.0	18	61,641,476 - 61,641,911	NCBI	Rnor6.0
Rnor_5.0	18	60,838,267 - 60,838,702	UniSTS	Rnor5.0
RGSC_v3.4	18	62,567,630 - 62,568,065	UniSTS	RGSC3.4
Celera	18	57,588,741 - 57,589,167	UniSTS
Cytogenetic Map	18	q12.1	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
7	24	62	15	16	3	7	3	2	74	34	59	32	40	13	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053678	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF135839	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AH010328	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000022784 ⟹ ENSRNOP00000022785

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	18	61,733,322 - 61,737,444 (-)	Ensembl
mRatBN7.2 Ensembl	18	59,463,737 - 59,467,431 (-)	Ensembl
Rnor_6.0 Ensembl	18	61,638,352 - 61,642,056 (-)	Ensembl

RefSeq Acc Id:

NM_053678 ⟹ NP_446130

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	61,733,322 - 61,737,444 (-)	NCBI
mRatBN7.2	18	59,463,347 - 59,467,469 (-)	NCBI
Rnor_6.0	18	61,638,352 - 61,642,056 (-)	NCBI
Rnor_5.0	18	60,835,143 - 60,838,847 (-)	NCBI
RGSC_v3.4	18	62,567,485 - 62,571,191 (+)	RGD
Celera	18	57,585,618 - 57,589,312 (-)	RGD

Sequence:

show sequence

ATGCACCTGCCGGGGTGCCCGCCAGCCATGGCCGACGGGAGCTTCTCGCTCGCTGGCCACCTGC
TCCGCAGCCCGGGCGGGAGCACGTCGCGTTTGCACAGCATCGAAGCCATCCTGGGCTTTACCAA
GGAAGACGGGATCCTAGACACCTTTCCTGCAGAGAGGAGCTCCAGGGGCTCGAAGGAGCGGGAT
CCCAGACTGGGTGCGCGGTCCGCCTGCCCCAAAGCTCCAGCCGGAGGCTCGGAGTCTTCCCCAC
CAGCAGCCCCGGGGCTCGTCCCGGAGTTCGAAGCTACTCGCCCCTGCTATCCCAAGGAGCAAGG
AGAGGCACGGCCGAGCCCCGGACTGCCGGTTGGGCCAGCAGCGGGCGATTCGAAGCTGTCGGAG
GAGGAGGAACCTCCCAAGAAGAAACACAGGCGCAACCGCACGACCTTCACCACGTATCAACTGC
ACGAGCTGGAACGTGCCTTTGAGAAGTCCCACTACCCCGACGTGTACAGCCGCGAAGAGTTGGC
CGGCAAGGTTAACCTACCCGAGGTTCGGGTCCAGGTGTGGTTCCAGAACCGTCGAGCCAAGTGG
AGACGCCAGGAGAAACTAGAAGTGTCGTCCATGAAGCTGCAGGACTCGCCCCTCCTCTCCTTCA
GCCGGTCCCCACCTTCCTCGGCACTGGCTCCGTTGGGCGGCCCGGGCAGCGGTAGCGGACCTCC
GGGGAGCGCCCTGCCGCTGGAGCCTTGGCTCGGGCCACCGCTGCCCGGCGGAGGTGCCACAGCG
CTGCAGAGCCTGCCAGGTTTCGGGCCGCCGGGGCAGGGTCTCCCGGCCAGCTACACGCCGCCAC
CGCCCTTCCTCAACTCCGCGCCCCTGGGTCCCGGTCTGCAGCAGCTCGGGCCGCCACCCGCGTA
CCCGTGCGCGCCGGCCTTCGGGGACAAGTTCTCGCTGGAAGAGGCGTACCCACGCAACAGCAGC
ATCGCCGCGCTGCGCCTGAAGGCCAAAGAGCACATCCAGGCCATCGGCAAGCCCTGGCAAGCCC
TCTAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_446130	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF61631	(Get FASTA)	NCBI Sequence Viewer
	AAK07422	(Get FASTA)	NCBI Sequence Viewer
	AAK07423	(Get FASTA)	NCBI Sequence Viewer
	EDM14699	(Get FASTA)	NCBI Sequence Viewer
	EDM14700	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000022785
	ENSRNOP00000022785.6
GenBank Protein	Q9JLT7	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446130 ⟸ NM_053678

- UniProtKB:

Q99PA4 (UniProtKB/Swiss-Prot), Q9JLT7 (UniProtKB/Swiss-Prot), A6IXR9 (UniProtKB/TrEMBL), D3ZLM8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MHLPGCPPAMADGSFSLAGHLLRSPGGSTSRLHSIEAILGFTKEDGILDTFPAERSSRGSKERD
PRLGARSACPKAPAGGSESSPPAAPGLVPEFEATRPCYPKEQGEARPSPGLPVGPAAGDSKLSE
EEEPPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQVWFQNRRAKW
RRQEKLEVSSMKLQDSPLLSFSRSPPSSALAPLGGPGSGSGPPGSALPLEPWLGPPLPGGGATA
LQSLPGFGPPGQGLPASYTPPPPFLNSAPLGPGLQQLGPPPAYPCAPAFGDKFSLEEAYPRNSS
IAALRLKAKEHIQAIGKPWQAL

hide sequence

Ensembl Acc Id:

ENSRNOP00000022785 ⟸ ENSRNOT00000022784

Protein Domains

Homeobox OAR

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9JLT7-F1-model_v2	AlphaFold	Q9JLT7	1-342	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620371	AgrOrtholog
BioCyc Gene	G2FUF-7199	BioCyc
Ensembl Genes	ENSRNOG00000016944	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000022784	ENTREZGENE
	ENSRNOT00000022784.6	UniProtKB/Swiss-Prot
Gene3D-CATH	Homeodomain-like	UniProtKB/Swiss-Prot
InterPro	Homeobox-like_sf	UniProtKB/Swiss-Prot
	Homeobox_CS	UniProtKB/Swiss-Prot
	Homeobox_dom	UniProtKB/Swiss-Prot
	OAR_dom	UniProtKB/Swiss-Prot
	RAX/RAX2	UniProtKB/Swiss-Prot
KEGG Report	rno:114213	UniProtKB/Swiss-Prot
NCBI Gene	114213	ENTREZGENE
PANTHER	PTHR46271	UniProtKB/Swiss-Prot
	RETINAL HOMEOBOX PROTEIN RX	UniProtKB/Swiss-Prot
Pfam	Homeodomain	UniProtKB/Swiss-Prot
	OAR	UniProtKB/Swiss-Prot
PhenoGen	Rax	PhenoGen
PROSITE	HOMEOBOX_1	UniProtKB/Swiss-Prot
	HOMEOBOX_2	UniProtKB/Swiss-Prot
	OAR	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000016944	RatGTEx
SMART	HOX	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF46689	UniProtKB/Swiss-Prot
UniProt	A6IXR8_RAT	UniProtKB/TrEMBL
	A6IXR9	ENTREZGENE, UniProtKB/TrEMBL
	D3ZLM8	ENTREZGENE, UniProtKB/TrEMBL
	Q99PA4	ENTREZGENE
	Q9JLT7	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	Q99PA4	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-01-20	Rax	retina and anterior neural fold homeobox			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Rax	retina and anterior neural fold homeobox			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM