Advanced Search (OLGA)

Gene: Acot12 (acyl-CoA thioesterase 12) Rattus norvegicus

Analyze

Symbol:

Acot12

Name:

acyl-CoA thioesterase 12

RGD ID:

619752

Description:

Enables acetyl-CoA hydrolase activity and identical protein binding activity. Involved in acyl-CoA metabolic process. Located in cytosol. Used to study liver cancer. Orthologous to human ACOT12 (acyl-CoA thioesterase 12); PARTICIPATES IN Leigh disease pathway; primary hyperoxaluria type 2 pathway; pyruvate decarboxylase deficiency pathway; INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

acetyl-coenzyme A thioesterase; acyl-CoA thioester hydrolase 12; acyl-coenzyme A thioesterase 12; Cach; CACH-1; cytoplasmic acetyl-CoA hydrolase; cytoplasmic acetyl-CoA hydrolase 1; cytosolic acetyl-CoA hydrolase; rACH; rCACH-1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ACOT12 (acyl-CoA thioesterase 12)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):	Acot12 (acyl-CoA thioesterase 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Acot12 (acyl-CoA thioesterase 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ACOT12 (acyl-CoA thioesterase 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ACOT12 (acyl-CoA thioesterase 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Acot12 (acyl-CoA thioesterase 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ACOT12 (acyl-CoA thioesterase 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ACOT12 (acyl-CoA thioesterase 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Acot12 (acyl-CoA thioesterase 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Acot12 (acyl-CoA thioesterase 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	DOK2 (docking protein 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	ACOT12 (acyl-CoA thioesterase 12)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Acot12 (acyl-CoA thioesterase 12)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	acot12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	acot12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	24,721,648 - 24,763,686 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	24,721,910 - 24,765,298 (+)	Ensembl				GRCr8
mRatBN7.2	2	22,986,867 - 23,027,538 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	22,986,626 - 23,027,536 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	30,027,186 - 30,067,868 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	28,127,527 - 28,168,209 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	22,946,811 - 22,987,990 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	2	24,823,532 - 24,864,221 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	2	24,849,422 - 24,890,115 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	2	24,774,182 - 24,814,873 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	2	24,667,956 - 24,708,653 (+)	NCBI		F344_StmMcwi
Rnor_6.0	2	20,857,056 - 20,901,656 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	20,857,202 - 20,901,659 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	48,055,053 - 48,096,606 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	21,984,849 - 22,035,224 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	19,090,138 - 19,130,693 (+)	NCBI		Celera
RGSC_v3.1	2	21,905,217 - 21,955,593 (+)	NCBI
Cytogenetic Map	2	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

liver cancer (IDA)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dichloroethane (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-(4-chlorophenyl)imidazo[2,1-b][1,3]thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

amiodarone (EXP,ISO)

ammonium chloride (EXP)

benzbromarone (EXP)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

buta-1,3-diene (ISO)

carbon nanotube (ISO)

chenodeoxycholic acid (ISO)

chlorotoluron (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

clofibrate (EXP,ISO)

cyclosporin A (ISO)

deoxycholic acid (ISO)

dichloroacetic acid (ISO)

dimethylarsinic acid (EXP,ISO)

farnesol (ISO)

furan (EXP)

glafenine (EXP)

glycochenodeoxycholic acid (ISO)

glycocholic acid (ISO)

glycodeoxycholic acid (ISO)

GW 4064 (ISO)

GW 7647 (ISO)

indometacin (EXP)

L-ethionine (EXP)

methapyrilene (EXP)

methylarsonic acid (ISO)

monosodium L-glutamate (ISO)

Muraglitazar (EXP)

N-Nitrosopyrrolidine (ISO)

nefazodone (EXP)

nitrofen (EXP)

O-methyleugenol (ISO)

okadaic acid (ISO)

oleic acid (ISO)

omeprazole (EXP)

paracetamol (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP,ISO)

pirinixic acid (EXP,ISO)

pravastatin (EXP,ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

Tesaglitazar (EXP)

tetrachloroethene (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

triclosan (ISO)

troglitazone (EXP,ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

acetyl-CoA metabolic process (IBA,ISO)

acyl-CoA metabolic process (IDA,IEA)

fatty acid metabolic process (IEA)

lipid metabolic process (IEA)

Cellular Component

cytoplasm (IBA)

cytosol (IBA,IDA,IEA,ISO)

Molecular Function

acetyl-CoA hydrolase activity (IBA,IDA,IEA,ISO)

ATP binding (IEA,ISO,ISS)

carboxylic ester hydrolase activity (IEA)

catalytic activity (IEA)

hydrolase activity (IEA)

identical protein binding (IEA,IPI,ISO)

lipid binding (IEA)

protein binding (ISO)

thiolester hydrolase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

Leigh disease pathway (ISO)

primary hyperoxaluria type 2 pathway (ISO)

pyruvate decarboxylase deficiency pathway (ISO)

pyruvate dehydrogenase E1 deficiency pathway (ISO)

pyruvate kinase deficiency of red cells pathway (ISO)

pyruvate metabolic pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The biphasic change of cytosolic acetyl-CoA hydrolase in rat liver during 3'-methyl-4-dimethylaminoazobenzene hepatocarcinogenesis.	Ebisuno S, etal., Jpn J Cancer Res. 1989 Feb;80(2):132-5.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Molecular cloning and functional expression of rat liver cytosolic acetyl-CoA hydrolase.	Suematsu N, etal., Eur J Biochem 2001 May;268(9):2700-9.
12.	On the regulation of cold-labile cytosolic and of mitochondrial acetyl-CoA hydrolase in rat liver.	Söling HD and Rescher C, Eur J Biochem. 1985 Feb 15;147(1):111-7.

Additional References at PubMed

PMID:12545200	PMID:16103133	PMID:16476568	PMID:23709691

Genomics

Comparative Map Data

Acot12
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	24,721,648 - 24,763,686 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	24,721,910 - 24,765,298 (+)	Ensembl				GRCr8
mRatBN7.2	2	22,986,867 - 23,027,538 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	22,986,626 - 23,027,536 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	30,027,186 - 30,067,868 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	28,127,527 - 28,168,209 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	22,946,811 - 22,987,990 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	2	24,823,532 - 24,864,221 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	2	24,849,422 - 24,890,115 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	2	24,774,182 - 24,814,873 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	2	24,667,956 - 24,708,653 (+)	NCBI		F344_StmMcwi
Rnor_6.0	2	20,857,056 - 20,901,656 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	20,857,202 - 20,901,659 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	48,055,053 - 48,096,606 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	21,984,849 - 22,035,224 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	19,090,138 - 19,130,693 (+)	NCBI		Celera
RGSC_v3.1	2	21,905,217 - 21,955,593 (+)	NCBI
Cytogenetic Map	2	q12	NCBI

ACOT12
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	81,308,609 - 81,394,134 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	81,329,862 - 81,394,191 (-)	Ensembl			hg38	GRCh38
GRCh37	5	80,625,815 - 80,689,953 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	80,661,839 - 80,725,712 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	5	80,661,838 - 80,725,712	NCBI
Celera	5	76,530,237 - 76,594,485 (-)	NCBI		Celera
Cytogenetic Map	5	q14.1	NCBI
HuRef	5	75,834,814 - 75,898,818 (-)	NCBI		HuRef
CHM1_1	5	80,058,759 - 80,122,826 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	81,793,197 - 81,878,724 (-)	NCBI		T2T-CHM13v2.0

Acot12
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	91,889,635 - 91,934,271 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	91,889,631 - 91,934,267 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	13	91,741,326 - 91,786,148 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	91,741,512 - 91,786,148 (+)	Ensembl			mm10	GRCm38
MGSCv37	13	91,881,126 - 91,925,753 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	13	92,215,760 - 92,260,387 (+)	NCBI		MGSCv36	mm8
Celera	13	95,375,248 - 95,419,932 (+)	NCBI		Celera
Cytogenetic Map	13	C3	NCBI
cM Map	13	47.43	NCBI

Acot12
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955418	28,829,144 - 28,875,486 (+)	Ensembl
ChiLan1.0	NW_004955418	28,829,316 - 28,872,629 (+)	NCBI	ChiLan1.0	ChiLan1.0

ACOT12
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	33,906,886 - 33,972,212 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	32,060,511 - 32,125,642 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	33,885,302 - 33,950,075 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	34,196,456 - 34,260,652 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	34,196,504 - 34,260,254 (+)	Ensembl			panPan2	panpan1.1

ACOT12
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	25,928,356 - 25,979,688 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	25,928,394 - 25,971,378 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	27,164,302 - 27,215,764 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	25,842,682 - 25,894,121 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	25,842,690 - 25,885,817 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	25,794,545 - 25,845,903 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	25,763,842 - 25,815,461 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	26,043,885 - 26,095,246 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Acot12
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	181,944,364 - 181,989,976 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936469	636,315 - 681,376 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936469	635,663 - 681,373 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ACOT12
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	89,855,162 - 89,905,111 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	2	89,855,159 - 89,905,105 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	91,785,951 - 91,815,862 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ACOT12
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	4	75,398,361 - 75,543,933 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	4	75,469,424 - 75,535,267 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666049	24,343,822 - 24,409,316 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Acot12
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624743	1,851,068 - 1,883,255 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624743	1,849,498 - 1,883,250 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Acot12
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	204,443,653 - 204,482,717 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Acot12
144 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	39
Count of miRNA genes:	39
Interacting mature miRNAs:	39
Transcripts:	ENSRNOT00000021675
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331764	Bp205	Blood pressure QTL 205	3.476		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	14368707	59368707	Rat
10755430	Coatc6	Coat color QTL 6		0.02576	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	13325041	58325041	Rat
1600379	Mcs18	Mammary carcinoma susceptibility QTL 18	2.6		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	9623581	44538110	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
7387318	Stl32	Serum triglyceride level QTL 32	3.2	0.0003	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	24117813	69117813	Rat
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	7605533	104774005	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
1578664	Bmd9	Bone mineral QTL density 9	5		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	2	5736325	50736325	Rat
738010	Lnnr3	Liver neoplastic nodule remodeling QTL 3	2.94		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	2	1	42977529	Rat
9590080	Insglur4	Insulin/glucose ratio QTL 4	28.7	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	2	6152767	51152767	Rat
1579916	Bp270	Blood pressure QTL 270		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	16051883	61051883	Rat
731167	Glom4	Glomerulus QTL 4	2.4	0.0082	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	2	22038044	67038044	Rat
731166	Mamtr2	Mammary tumor resistance QTL 2		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	9623581	54623581	Rat
61368	Mcs1	Mammary carcinoma susceptibility QTL 1	4.4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	9623581	25054526	Rat
731184	Mamtr4	Mammary tumor resistance QTL 4		0.0003	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	18227137	63227137	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
11	6	17	56	86	85	55	22	55	6	209	59	36	78	44	30	1	1

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_130747	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008760628	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063281213	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB040609	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473955	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000078919 ⟹ ENSRNOP00000075534

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	24,721,910 - 24,765,298 (+)	Ensembl
mRatBN7.2 Ensembl	2	22,986,626 - 23,027,536 (+)	Ensembl
Rnor_6.0 Ensembl	2	20,857,202 - 20,901,659 (+)	Ensembl

RefSeq Acc Id:

NM_130747 ⟹ NP_570103

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	24,721,959 - 24,762,628 (+)	NCBI
mRatBN7.2	2	22,986,867 - 23,027,538 (+)	NCBI
Dahl_SR_JrHsd	2	24,823,532 - 24,864,221 (+)	NCBI
Lyon_Normotensive	2	24,849,422 - 24,890,115 (+)	NCBI
Lyon_Hypertensive	2	24,774,182 - 24,814,873 (+)	NCBI
F344_StmMcwi	2	24,667,956 - 24,708,653 (+)	NCBI
Rnor_6.0	2	20,857,428 - 20,898,981 (+)	NCBI
Rnor_5.0	2	48,055,053 - 48,096,606 (-)	NCBI
RGSC_v3.4	2	21,984,849 - 22,035,224 (+)	RGD
Celera	2	19,090,138 - 19,130,693 (+)	RGD

Sequence:

show sequence

GAGCTCTCTCAGCCGGGACGATGGAACCGACAGTGGCTCCCGGCGAGGTGCTCATGAGCCAGGC
CATCCAGCCTGCGCACGCCGACTCGCGCGGCGAGCTGAGCGCCGGGCAACTACTTAAGTGGATG
GACACCACTGCCTGCCTGGCCGCTGAAAAGCATGCTGGGATTTCCTGTGTCACAGCCTCAATGG
ATGACATTCTGTTTGAGGACACGGCTAGAATTGGACAGATTGTTACCATCAGAGCAAAAGTGAC
TAGGGCGTTCAGCACAAGCATGGAGATCAGTATCAAGGTCAGAGTCCAGGACAAGTTCACTGGC
ATCCAGAAGCTCCTCTGTGTGGCTTTCTCGACATTTGTAGTTAAACCGCTCGGCAAAGAAAAGG
TTCACTTGAAACCTGTTCTGCTTCAAACGGAGCAAGAGCAAGTGGAGCACCGTCTGGCCTCCGA
GAGGAGGAAAGTCCGGTTACAGCATGAGAACACCTTCAGCAACATTATGAAGGAAAGCAACTGG
CTCAGGGATCCCGTTTGTAATGAAGAGGAAGGAACGGCCACCACCATGGCCACCTCTGTCCAGA
GCATTGAGCTTGTCCTCCCACCCCACGCAAACCACCACGGAAACACATTTGGCGGGCAGATCAT
GGCGTGGATGGAGACAGTCGCAACCATTTCCGCAAGCCGCCTGTGTCATGGGCATCCCTTTCTG
AAGTCCGTGGATATGTTTAAATTCCGGGGACCGTCCACAGTTGGGGACCGCCTTGTCTTCAATG
CCATCGTCAACAACACCTTTCAGAACAGTGTGGAAGTTGGCGTACGTGTTGAGGCCTTTGACTG
TCGGGAGTGGGCCGAGGGCCAAGGCCGCCACATCAACAGCGCTTTTCTCATTTACAATGCTGTT
GATGACCAGGAGGAACTCATCACCTTTCCCAGAATCCAGCCCATTTCAAAGGATGATTTTCGAC
GGTACCAGGGAGCTATTGCACGGAGGAGAATTCGCCTGGGCAGGAAATATGTTATTTCCCACAA
GAAAGAAGTCCCACTTGGCACACAATGGGATATAAGCAAAAAGGGATCCATAAGTAACACCAAT
GTGGAAGCTCTCAAAAATCTGGCATCCAAAAGCGGTTGGGAGATCACCACCACCTTGGAGAAGA
TAAAAATATATACACTGGAAGAGCAAGATGCCATATCTGTAAAGGTGGAAAAACAGGTTGGAAG
TCCAGCCCGCGTGGCTTATCATCTCTTGTCCGACTTCACAAAGCGCCCTTTATGGGACCCCCAT
TACATATCTTGTGAAGTCATAGACCAGGTGAGTGAGGACGATCAGATATATTACATCACCTGCT
CGGTGGTAAATGGAGACAAACCCAAGGACTTCGTAGTACTTGTGTCACAAAGAAAGCCCCTCAA
GGACGACAACACCTACATCGTGGCACTAATGTCAGTGGTACTGCCGTCTGTCCCTCCATCTCCA
CAGTACATCAGAAGCCAGGTCATTTGTGCTGGGTTCCTCATCCAGCCTGTCGACAGCAGTTCGT
GCACTGTAGCATACCTGAACCAGATGTCAGACAGCATCCTCCCTTACTTTGCTGGCAATATTGG
TGGCTGGTCAAAATCCATTGAGGAAGCTGCAGCCTCTTGTATAAAATTCATAGAGAACGCCACT
CACGATGGACTTAAAAGTGTGTTATAAATGGTCAACTCTCAGAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063281213 ⟹ XP_063137283

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	24,721,648 - 24,763,686 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_570103	(Get FASTA)	NCBI Sequence Viewer
	XP_063137283	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAB39852	(Get FASTA)	NCBI Sequence Viewer
	EDM10006	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000075534
GenBank Protein	Q99NB7	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_570103 ⟸ NM_130747

- UniProtKB:

Q99NB7 (UniProtKB/Swiss-Prot), A6I4P8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEPTVAPGEVLMSQAIQPAHADSRGELSAGQLLKWMDTTACLAAEKHAGISCVTASMDDILFED
TARIGQIVTIRAKVTRAFSTSMEISIKVRVQDKFTGIQKLLCVAFSTFVVKPLGKEKVHLKPVL
LQTEQEQVEHRLASERRKVRLQHENTFSNIMKESNWLRDPVCNEEEGTATTMATSVQSIELVLP
PHANHHGNTFGGQIMAWMETVATISASRLCHGHPFLKSVDMFKFRGPSTVGDRLVFNAIVNNTF
QNSVEVGVRVEAFDCREWAEGQGRHINSAFLIYNAVDDQEELITFPRIQPISKDDFRRYQGAIA
RRRIRLGRKYVISHKKEVPLGTQWDISKKGSISNTNVEALKNLASKSGWEITTTLEKIKIYTLE
EQDAISVKVEKQVGSPARVAYHLLSDFTKRPLWDPHYISCEVIDQVSEDDQIYYITCSVVNGDK
PKDFVVLVSQRKPLKDDNTYIVALMSVVLPSVPPSPQYIRSQVICAGFLIQPVDSSSCTVAYLN
QMSDSILPYFAGNIGGWSKSIEEAAASCIKFIENATHDGLKSVL

hide sequence

Ensembl Acc Id:

ENSRNOP00000075534 ⟸ ENSRNOT00000078919

RefSeq Acc Id:	XP_063137283 ⟸ XM_063281213
- Peptide Label:	isoform X1
- UniProtKB:	A0A0G2KAU8 (UniProtKB/TrEMBL)

Protein Domains

HotDog ACOT-type START

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q99NB7-F1-model_v2	AlphaFold	Q99NB7	1-556	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619752	AgrOrtholog
BioCyc Gene	G2FUF-54878	BioCyc
Ensembl Genes	ENSRNOG00000061414	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000078919	ENTREZGENE
Gene3D-CATH	3.30.530.20	UniProtKB/Swiss-Prot
	Hotdog Thioesterase	UniProtKB/Swiss-Prot
InterPro	Cytosol_ACT	UniProtKB/Swiss-Prot
	HOTDOG_ACOT	UniProtKB/Swiss-Prot
	HotDog_dom_sf	UniProtKB/Swiss-Prot
	START-like_dom_sf	UniProtKB/Swiss-Prot
	START_lipid-bd_dom	UniProtKB/Swiss-Prot
	Thioestr_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:170570	UniProtKB/Swiss-Prot
NCBI Gene	170570	ENTREZGENE
PANTHER	ACETYL-COENZYME A THIOESTERASE	UniProtKB/Swiss-Prot
	PTHR11049	UniProtKB/Swiss-Prot
Pfam	4HBT	UniProtKB/Swiss-Prot
	START	UniProtKB/Swiss-Prot
PhenoGen	Acot12	PhenoGen
PROSITE	HOTDOG_ACOT	UniProtKB/Swiss-Prot
	START	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000061414	RatGTEx
SMART	START	UniProtKB/Swiss-Prot
Superfamily-SCOP	Bet v1-like	UniProtKB/Swiss-Prot
	SSF54637	UniProtKB/Swiss-Prot
UniProt	A0A0G2KAU8	ENTREZGENE, UniProtKB/TrEMBL
	A6I4P8	ENTREZGENE, UniProtKB/TrEMBL
	ACO12_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Acot12	acyl-CoA thioesterase 12	Cach	cytosolic acetyl-CoA hydrolase	Symbol and Name updated	1299863	APPROVED
2005-01-20	Cach	cytosolic acetyl-CoA hydrolase	rACH	cytoplasmic acetyl-CoA hydrolase	Symbol and Name updated	1299863	APPROVED
2002-08-07	rACH	cytoplasmic acetyl-CoA hydrolase			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_protein	556 amino-acid residues and 62,017 Da	633789

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)