Advanced Search (OLGA)

Gene: Psme2 (proteasome activator subunit 2) Rattus norvegicus

Analyze

Symbol:

Psme2 (Ensembl: LOC100362709)

Name:

proteasome activator subunit 2 (Ensembl:proteasome activator complex subunit 2-like)

RGD ID:

3430

Description:

Predicted to enable endopeptidase activator activity and identical protein binding activity. Predicted to be involved in regulation of G1/S transition of mitotic cell cycle and regulation of proteasomal protein catabolic process. Predicted to act upstream of or within antigen processing and presentation of exogenous antigen. Predicted to be part of proteasome activator complex. Predicted to be active in cytoplasm and nucleoplasm. Orthologous to human PSME2 (proteasome activator subunit 2); PARTICIPATES IN antigen processing and presentation pathway; ubiquitin/proteasome degradation pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

11S regulator complex subunit beta; activator of multicatalytic protease subunit 2; PA28b; PA28beta; protease (prosome, macropain) 28 subunit, beta; proteasome (prosome, macropain) 28 subunit, beta; proteasome (prosome, macropain) activator subunit 2; proteasome activator 28 subunit beta; proteasome activator complex subunit 2; REG-beta

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PSME2 (proteasome activator subunit 2)	RGD	RGD
Mus musculus (house mouse):	Psme2 (proteasome (prosome, macropain) activator subunit 2 (PA28 beta))	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Psme2 (proteasome activator subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PSME2 (proteasome activator subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PSME2 (proteasome activator subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Psme2 (proteasome activator subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PSME2 (proteasome activator subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PSME2 (proteasome activator subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Psme2 (proteasome activator subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Psme2 (proteasome activator subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PSME2 (proteasome activator subunit 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Psme2 (proteasome (prosome, macropain) activator subunit 2 (PA28 beta))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Psme2b (protease (prosome, macropain) activator subunit 2B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	psme2 (proteasome activator subunit 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y66D12A.9	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	REG	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	psme2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	psme2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	33,048,452 - 33,053,055 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	33,048,457 - 33,053,102 (-)	Ensembl				GRCr8
mRatBN7.2	15	29,078,495 - 29,082,794 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	29,078,500 - 29,082,946 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	15	30,924,197 - 30,928,500 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	32,071,403 - 32,075,706 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	30,313,749 - 30,318,048 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	34,265,552 - 34,269,851 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	34,265,557 - 34,269,851 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	15	38,155,747 - 38,160,046 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	33,722,370 - 33,726,669 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	28,654,415 - 28,658,714 (-)	NCBI		Celera
RGSC_v3.1	15	33,738,074 - 33,742,369 (-)	NCBI
Cytogenetic Map	15	p13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

esophagus squamous cell carcinoma (ISO)

Experimental Liver Cirrhosis (ISO)

human immunodeficiency virus infectious disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP)

2,6-dimethoxyphenol (ISO)

3-methylcholanthrene (ISO)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (EXP)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

all-trans-retinoic acid (ISO)

amitrole (EXP)

ammonium chloride (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

bisphenol F (EXP,ISO)

bleomycin A2 (EXP)

Butylbenzyl phthalate (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

decabromodiphenyl ether (EXP)

deguelin (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP,ISO)

diuron (ISO)

doxorubicin (ISO)

enzyme inhibitor (ISO)

epoxiconazole (ISO)

ethanol (EXP)

flutamide (EXP)

folic acid (ISO)

folpet (ISO)

FR900359 (ISO)

furfural (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

inulin (ISO)

ivermectin (ISO)

L-ascorbic acid (ISO)

lead diacetate (ISO)

lithium atom (EXP)

lithium hydride (EXP)

methimazole (EXP)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

N-nitrosodimethylamine (EXP)

nickel atom (ISO)

ochratoxin A (ISO)

paracetamol (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

propiconazole (EXP)

rotenone (ISO)

sodium arsenite (ISO)

sodium chloride (ISO)

sulfadimethoxine (EXP)

tamibarotene (ISO)

tetrachloromethane (EXP)

thalidomide (ISO)

thioacetamide (EXP)

thiram (ISO)

tolcapone (EXP)

triptonide (ISO)

tungsten (ISO)

vancomycin (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

antigen processing and presentation of exogenous antigen (IEA,ISO)

regulation of G1/S transition of mitotic cell cycle (IBA)

regulation of proteasomal protein catabolic process (IBA,ISO)

Cellular Component

cytoplasm (IBA)

nucleoplasm (IBA)

proteasome activator complex (IEA)

proteasome complex (IEA)

Molecular Function

endopeptidase activator activity (IBA,ISO)

identical protein binding (ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

antigen processing and presentation pathway (IEA)

ubiquitin/proteasome degradation pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Primary structures of two homologous subunits of PA28, a gamma-interferon-inducible protein activator of the 20S proteasome.	Ahn JY, etal., FEBS Lett 1995 Jun 5;366(1):37-42.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334	PMID:15944286	PMID:16189514	PMID:19056867	PMID:19946888	PMID:23376485	PMID:23533145	PMID:36715894

Genomics

Comparative Map Data

Psme2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	33,048,452 - 33,053,055 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	33,048,457 - 33,053,102 (-)	Ensembl				GRCr8
mRatBN7.2	15	29,078,495 - 29,082,794 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	29,078,500 - 29,082,946 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	15	30,924,197 - 30,928,500 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	32,071,403 - 32,075,706 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	30,313,749 - 30,318,048 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	34,265,552 - 34,269,851 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	34,265,557 - 34,269,851 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	15	38,155,747 - 38,160,046 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	33,722,370 - 33,726,669 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	28,654,415 - 28,658,714 (-)	NCBI		Celera
RGSC_v3.1	15	33,738,074 - 33,742,369 (-)	NCBI
Cytogenetic Map	15	p13	NCBI

PSME2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	24,143,365 - 24,146,610 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	24,143,362 - 24,147,570 (-)	Ensembl			hg38	GRCh38
GRCh37	14	24,612,574 - 24,615,819 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	23,682,414 - 23,685,695 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	14	23,682,413 - 23,685,695	NCBI
Celera	14	4,477,042 - 4,480,323 (-)	NCBI		Celera
Cytogenetic Map	14	q12	NCBI
HuRef	14	4,727,638 - 4,730,919 (-)	NCBI		HuRef
CHM1_1	14	24,611,243 - 24,614,524 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	14	18,341,674 - 18,344,919 (-)	NCBI		T2T-CHM13v2.0

Psme2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	55,824,897 - 55,828,558 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	55,824,898 - 55,828,570 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	14	55,587,440 - 55,591,101 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	55,587,441 - 55,591,113 (-)	Ensembl			mm10	GRCm38
MGSCv37	14	56,206,277 - 56,209,938 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	14	54,541,511 - 54,545,172 (-)	NCBI		MGSCv36	mm8
Celera	14	53,392,500 - 53,396,161 (-)	NCBI		Celera
Cytogenetic Map	14	C3	NCBI
cM Map	14	28.19	NCBI

Psme2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955409	36,252,847 - 36,257,021 (+)	Ensembl
ChiLan1.0	NW_004955409	36,252,847 - 36,257,021 (+)	NCBI	ChiLan1.0	ChiLan1.0

PSME2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	25,497,735 - 25,501,589 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	24,714,227 - 24,718,201 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	4,919,628 - 4,922,952 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	23,043,807 - 23,047,296 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	23,043,807 - 23,047,296 (-)	Ensembl			panPan2	panpan1.1

PSME2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	4,137,247 - 4,141,380 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	4,137,247 - 4,140,706 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	4,058,934 - 4,062,482 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	4,247,825 - 4,251,369 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	4,247,825 - 4,251,981 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	3,938,451 - 3,941,999 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	4,000,202 - 4,003,738 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	4,262,361 - 4,265,901 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Psme2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	35,987,005 - 35,991,113 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936722	397,876 - 402,167 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936722	398,406 - 401,987 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PSME2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	75,153,965 - 75,157,870 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	75,154,570 - 75,157,871 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	80,425,857 - 80,429,167 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Pig Cytomap	7	q12-q23	NCBI

PSME2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	1,129,389 - 1,133,289 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	1,129,419 - 1,132,596 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666036	12,811,110 - 12,814,585 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Psme2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624820	8,389,286 - 8,393,498 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624820	8,389,348 - 8,393,498 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Psme2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	12	69,416,256 - 69,420,080 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Psme2
23 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	258
Count of miRNA genes:	173
Interacting mature miRNAs:	195
Transcripts:	ENSRNOT00000026279
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1641913	Colcr2	Colorectal carcinoma resistance QTL 2	6.57	0.0197	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	15	2315759	47315759	Rat
5684946	Bss98	Bone structure and strength QTL 98	3.9	0.0026	tibia strength trait (VT:1000284)	tibia ultimate force (CMO:0001734)	15	1	39411584	Rat
1641887	Alcrsp14	Alcohol response QTL 14			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	15	1	44836456	Rat
738017	Hcas7	Hepatocarcinoma susceptibility QTL 7	2.91		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	15	2315759	53331089	Rat
152025253	Hrtrt24	Heart rate QTL 24	3.82		heart pumping trait (VT:2000009)		15	31855803	92671517	Rat
10755503	Bp391	Blood pressure QTL 391	2.37		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	15	22728353	42072050	Rat
10054130	Srcrt8	Stress Responsive Cort QTL 8	2.18	0.0085	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	15	28527732	73527732	Rat
1578646	Bmd18	Bone mineral density QTL 18	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	15	25285835	104695021	Rat
2324620	Coatc3	Coat color QTL 3			coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	15	22336351	52597086	Rat
1578647	Bmd17	Bone mineral density QTL 17	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	15	25285835	104695021	Rat
61424	Scl1	Serum cholesterol level QTL 1	7.7	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	15	19155762	87086765	Rat
10401805	Kidm51	Kidney mass QTL 51			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	15	2785923	47785923	Rat
2317750	Glom26	Glomerulus QTL 26	4.3		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	15	14926594	71614418	Rat
631550	Bw7	Body weight QTL 7	3.6		body mass (VT:0001259)	body weight (CMO:0000012)	15	22336351	67336351	Rat
1578660	Bss19	Bone structure and strength QTL 19	4.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	15	25285835	104695021	Rat

Markers in Region

RH129915

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	34,722,815 - 34,723,021 (+)	MAPPER	mRatBN7.2
mRatBN7.2	15	29,079,099 - 29,079,905 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	34,266,157 - 34,266,962	NCBI	Rnor6.0
Rnor_6.0	1	37,559,558 - 37,559,763	NCBI	Rnor6.0
Rnor_5.0	15	38,156,352 - 38,157,157	UniSTS	Rnor5.0
Rnor_5.0	1	38,939,804 - 38,940,009	UniSTS	Rnor5.0
RGSC_v3.4	15	33,722,975 - 33,723,780	UniSTS	RGSC3.4
RGSC_v3.4	17	4,920,805 - 4,921,010	UniSTS	RGSC3.4
Celera	15	28,655,020 - 28,655,825	UniSTS
Celera	1	33,295,388 - 33,295,593	UniSTS
Cytogenetic Map	17	p14	UniSTS
Cytogenetic Map	15	p13	UniSTS

UniSTS:144282

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	29,079,470 - 29,079,918 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	34,266,528 - 34,266,975	NCBI	Rnor6.0
Rnor_5.0	15	38,156,723 - 38,157,170	UniSTS	Rnor5.0
RGSC_v3.4	15	33,723,346 - 33,723,793	UniSTS	RGSC3.4
Celera	15	28,655,391 - 28,655,838	UniSTS
Cytogenetic Map	15	p13	UniSTS

RH71322

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	34,722,825 - 34,722,996 (+)	MAPPER	mRatBN7.2
mRatBN7.2	13	38,190,170 - 38,190,341 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	43,080,194 - 43,080,364	NCBI	Rnor6.0
Rnor_6.0	1	37,559,568 - 37,559,738	NCBI	Rnor6.0
Rnor_5.0	13	48,181,613 - 48,181,783	UniSTS	Rnor5.0
Rnor_5.0	1	38,939,814 - 38,939,984	UniSTS	Rnor5.0
RGSC_v3.4	13	39,308,325 - 39,308,495	UniSTS	RGSC3.4
RGSC_v3.4	17	4,920,815 - 4,920,985	UniSTS	RGSC3.4
Celera	13	38,513,040 - 38,513,210	UniSTS
Celera	1	33,295,398 - 33,295,568	UniSTS
Cytogenetic Map	13	q11	UniSTS
Cytogenetic Map	17	p14	UniSTS
Cytogenetic Map	15	p13	UniSTS

MARC_4677-4678:996679594:1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	34,722,607 - 34,722,680 (+)	MAPPER	mRatBN7.2
mRatBN7.2	15	29,080,316 - 29,081,409 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	34,267,374 - 34,268,466	NCBI	Rnor6.0
Rnor_6.0	1	37,559,350 - 37,559,422	NCBI	Rnor6.0
Rnor_5.0	15	38,157,569 - 38,158,661	UniSTS	Rnor5.0
Rnor_5.0	1	38,939,596 - 38,939,668	UniSTS	Rnor5.0
RGSC_v3.4	15	33,724,192 - 33,725,284	UniSTS	RGSC3.4
RGSC_v3.4	17	4,920,597 - 4,920,669	UniSTS	RGSC3.4
Celera	15	28,656,237 - 28,657,329	UniSTS
Celera	1	33,295,180 - 33,295,252	UniSTS
Cytogenetic Map	17	p14	UniSTS
Cytogenetic Map	15	p13	UniSTS

UniSTS:256484

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	29,081,379 - 29,082,946 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	34,268,437 - 34,270,003	NCBI	Rnor6.0
Rnor_5.0	15	38,158,632 - 38,160,198	UniSTS	Rnor5.0
RGSC_v3.4	15	33,725,255 - 33,726,821	UniSTS	RGSC3.4
Celera	15	28,657,300 - 28,658,866	UniSTS
Cytogenetic Map	15	p13	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017257	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274188	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC058486	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC097331	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474049	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D45250	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226805	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227049	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232840	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233763	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000026279 ⟹ ENSRNOP00000026279

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	15	33,048,457 - 33,052,751 (-)	Ensembl
mRatBN7.2 Ensembl	15	29,078,500 - 29,082,794 (-)	Ensembl
Rnor_6.0 Ensembl	15	34,265,557 - 34,269,851 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095946 ⟹ ENSRNOP00000088562

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	15	33,048,457 - 33,052,839 (-)	Ensembl
mRatBN7.2 Ensembl	15	29,078,500 - 29,082,946 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000132814 ⟹ ENSRNOP00000100666

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	15	33,048,457 - 33,053,102 (-)	Ensembl

RefSeq Acc Id:

NM_017257 ⟹ NP_058953

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	33,048,452 - 33,052,751 (-)	NCBI
mRatBN7.2	15	29,078,495 - 29,082,794 (-)	NCBI
Rnor_6.0	15	34,265,552 - 34,269,851 (-)	NCBI
Rnor_5.0	15	38,155,747 - 38,160,046 (-)	NCBI
RGSC_v3.4	15	33,722,370 - 33,726,669 (-)	RGD
Celera	15	28,654,415 - 28,658,714 (-)	RGD

Sequence:

show sequence

GCATGGCCAAGCCTTGTGGGGTTCGCTTGAGTGGAGAAGCCCGTAAACAGGTGGATGCCTTCAG
ACAAAATCTTTTCCAGGAGGCTGAGGACTTCCTTTGCACTTTCTTGCCACGGAAAATCATATCC
CTGAGTCAGCTCTTGCAAGAGGATTCCCTCAATGTGGCTGACCTCTCCTCCCTCCGGGCTCCTC
TGGACATCCCTATCCCAGATCCCCCACCCAAGGATGATGAGATGGAAACCGAGCAGGAGAAGAA
AGAAGTCCCTAAGTGTGGCTTCCTCCCTGGGAATGAGAAGCTTCTGGCCCTGCTTGCCTTGGTT
AAGCCAGAAGTCTGGACTCTCAAAGAGAAGTGCATTCTGGTAATCACATGGATCCAGCACCTGA
TCCCCAAGATTGAGGACGGAAATGATTTTGGGGTGGCAATTCAGGAGAAGGTGCTGGAGAGAGT
GAATGCTGTCAAGACCAAAGTGGAAGCCTTCCAGACAGCCATCTCCAAGTATTTCTCAGAGCGT
GGGGATGCTGTAGCCAAGGCCTCCAAGGACACCCATGTAATGGATTACCGGGCCTTGGTGCACG
AGCGAGATGAAGCAGCCTATGGGGCGCTTAGGGCCATGGTGCTGGACCTGAGAGCCTTCTATGC
TGAGCTTCATCACATCATCAGCAGCAACCTAGAGAAAATTGTCAACCCAAAGGGTGAAGAAAAG
CCATCTATGTACTGAGCAAAGGATTAGAAGGAAAATAAATGATTTATACTTTATGTATATTACC
TCTGTCGTTCATTGAGAGAGCATTTATCGAGGGCCTCCATTGTCTCCATGGTAATGAATACGGT
GATGAACGTGGGAGAGGGTTGGCTGGAGGGATGGCTCAGCAGTTAAGAGCACTGGCTGTTCTTC
CAGAGGGACCCAGGCTCCAATTCCCAGCACCCAGAAGATGACTAATAACTCTGTAACTCCAGTT
CCAGGGGATCTGGACACCCTCTTCTGACCTCTACAGACACCAGATATGCACATATGATGTCCAC
GCAAATGTGCAAGCAAAACACTCATCACATAAAGCAAAAACAAAAAAAAGTTGAAAGATTAAGT
GGGGGAGGGTTCTAGGAAGTCGAGGATGGGCTTGAGGCCCATTGTGTTTTTCACAGATCATTCT
AAAGAATGGGGTAGGGGCTGGAGAAATGGCTCAGTGGTTAAAAACACTGACTGCTCATCCTAAG
GTCCTGAGTTCAAATCCCAGCAACCACATGGTGGCTCACAACCAACTGTAATGAGATCTGATGC
CCTCTTCTGCTGTGTCTGAAGACAGCTACAGTGTACTTATAAATAAATAAATATTTTTAAAAAA
AAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063274188 ⟹ XP_063130258

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	33,049,038 - 33,053,055 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_058953	(Get FASTA)	NCBI Sequence Viewer
	XP_063130258	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH58486	(Get FASTA)	NCBI Sequence Viewer
	AAH97331	(Get FASTA)	NCBI Sequence Viewer
	BAA08207	(Get FASTA)	NCBI Sequence Viewer
	EDM14244	(Get FASTA)	NCBI Sequence Viewer
	EDM14245	(Get FASTA)	NCBI Sequence Viewer
	EDM14246	(Get FASTA)	NCBI Sequence Viewer
	EDM14247	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000026279
	ENSRNOP00000026279.6
	ENSRNOP00000100666
GenBank Protein	Q63798	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_058953 ⟸ NM_017257

- UniProtKB:

Q4QR96 (UniProtKB/Swiss-Prot), Q63798 (UniProtKB/Swiss-Prot), A6KH16 (UniProtKB/TrEMBL), A0A8I6A5C7 (UniProtKB/TrEMBL), A6KH15 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAKPCGVRLSGEARKQVDAFRQNLFQEAEDFLCTFLPRKIISLSQLLQEDSLNVADLSSLRAPL
DIPIPDPPPKDDEMETEQEKKEVPKCGFLPGNEKLLALLALVKPEVWTLKEKCILVITWIQHLI
PKIEDGNDFGVAIQEKVLERVNAVKTKVEAFQTAISKYFSERGDAVAKASKDTHVMDYRALVHE
RDEAAYGALRAMVLDLRAFYAELHHIISSNLEKIVNPKGEEKPSMY

hide sequence

Ensembl Acc Id:

ENSRNOP00000026279 ⟸ ENSRNOT00000026279

Ensembl Acc Id:

ENSRNOP00000088562 ⟸ ENSRNOT00000095946

RefSeq Acc Id:	XP_063130258 ⟸ XM_063274188
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6A5C7 (UniProtKB/TrEMBL), A6KH15 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000100666 ⟸ ENSRNOT00000132814

Protein Domains

Proteasome activator PA28 C-terminal Proteasome activator PA28 N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q63798-F1-model_v2	AlphaFold	Q63798	1-238	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699674

Promoter ID:

EPDNEW_R10197

Type:

initiation region

Name:

Psme2_1

Description:

proteasome activator subunit 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	15	34,269,877 - 34,269,937	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3430	AgrOrtholog
BioCyc Gene	G2FUF-13710	BioCyc
Ensembl Genes	ENSRNOG00000019246	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000026279	ENTREZGENE
	ENSRNOT00000026279.8	UniProtKB/Swiss-Prot
	ENSRNOT00000132814	ENTREZGENE
Gene3D-CATH	1.20.120.180	UniProtKB/Swiss-Prot
	1.20.5.120	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:6918985	IMAGE-MGC_LOAD
	IMAGE:7389180	IMAGE-MGC_LOAD
InterPro	PA28_C	UniProtKB/Swiss-Prot
	PA28_C_sf	UniProtKB/Swiss-Prot
	PA28_N_sf	UniProtKB/Swiss-Prot
	Proteasome_activ_PA28	UniProtKB/Swiss-Prot
	Proteasome_activ_PA28_N	UniProtKB/Swiss-Prot
	Proteasome_activ_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:29614	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:114338	IMAGE-MGC_LOAD
	MGC:72873	IMAGE-MGC_LOAD
NCBI Gene	29614	ENTREZGENE
PANTHER	PROTEASOME ACTIVATOR COMPLEX SUBUNIT 2	UniProtKB/Swiss-Prot
	PTHR10660	UniProtKB/Swiss-Prot
Pfam	PA28_alpha	UniProtKB/Swiss-Prot
	PA28_beta	UniProtKB/Swiss-Prot
PhenoGen	Psme2	PhenoGen
RatGTEx	ENSRNOG00000019246	RatGTEx
Superfamily-SCOP	SSF47216	UniProtKB/Swiss-Prot
UniProt	A0A8I6A5C7	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0L9M0_RAT	UniProtKB/TrEMBL
	A6KH15	ENTREZGENE, UniProtKB/TrEMBL
	A6KH16	ENTREZGENE, UniProtKB/TrEMBL
	A6KH17_RAT	UniProtKB/TrEMBL
	A6KH18_RAT	UniProtKB/TrEMBL
	PSME2_RAT	UniProtKB/Swiss-Prot
	Q4QR96	ENTREZGENE
	Q63798	ENTREZGENE
UniProt Secondary	Q4QR96	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-07-21	Psme2	proteasome activator subunit 2	Psme2	proteasome (prosome, macropain) activator subunit 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-12-15	Psme2	proteasome (prosome, macropain) activator subunit 2	Psme2	proteasome (prosome, macropain) 28 subunit, beta	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-11-17	Psme2	proteasome (prosome, macropain) 28 subunit, beta		protease (prosome, macropain) 28 subunit, beta	Name updated	1299863	APPROVED
2002-06-10	Psme2	protease (prosome, macropain) 28 subunit, beta			Name updated	70584	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)