Advanced Search (OLGA)

Gene: Ppm1a (protein phosphatase, Mg2+/Mn2+ dependent, 1A) Rattus norvegicus

Analyze

Symbol:

Ppm1a

Name:

protein phosphatase, Mg2+/Mn2+ dependent, 1A

RGD ID:

3373

Description:

Enables phosphoprotein phosphatase activity and transmembrane transporter binding activity. Predicted to be involved in several processes, including N-terminal protein myristoylation; protein dephosphorylation; and regulation of signal transduction. Predicted to act upstream of or within cellular response to transforming growth factor beta stimulus; negative regulation of BMP signaling pathway; and positive regulation of protein export from nucleus. Located in neuron projection. Orthologous to human PPM1A (protein phosphatase, Mg2+/Mn2+ dependent 1A); PARTICIPATES IN Bone morphogenetic proteins signaling pathway; mitogen activated protein kinase signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3H-1,2-dithiole-3-thione; acrylamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

IA; MGC114340; PP2C-alpha; Pp2c1; protein phosphatase 1A; protein phosphatase 1A, magnesium dependent, alpha isoform; protein phosphatase 2C isoform alpha; protein phosphatase IA; Protein phosphatase type 1A (formely 2C) Mg-dependent alpha isoform; Protein phosphatase type 1A (formely 2C), Mg-dependent, alpha isoform

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PPM1A (protein phosphatase, Mg2+/Mn2+ dependent 1A)	HGNC	HomoloGene, NCBI, Panther
Mus musculus (house mouse):	Ppm1a (protein phosphatase 1A, magnesium dependent, alpha isoform)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ppm1a (protein phosphatase, Mg2+/Mn2+ dependent 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PPM1A (protein phosphatase, Mg2+/Mn2+ dependent 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PPM1A (protein phosphatase, Mg2+/Mn2+ dependent 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ppm1a (protein phosphatase, Mg2+/Mn2+ dependent 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PPM1A (protein phosphatase, Mg2+/Mn2+ dependent 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PPM1A (protein phosphatase, Mg2+/Mn2+ dependent 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ppm1a (protein phosphatase, Mg2+/Mn2+ dependent 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	PPM1N (protein phosphatase, Mg2+/Mn2+ dependent 1N (putative))	HGNC	Treefam
Alliance orthologs ³
Homo sapiens (human):	PPM1A (protein phosphatase, Mg2+/Mn2+ dependent 1A)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ppm1a (protein phosphatase 1A, magnesium dependent, alpha isoform)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ppm1ab (protein phosphatase, Mg2+/Mn2+ dependent, 1Ab)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	ppm1aa (protein phosphatase, Mg2+/Mn2+ dependent, 1Aa)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PTC2	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PTC3	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	alph	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ppm-1.A	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ppm-1.A	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG6036	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG6036	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	ppm1a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	ppm1a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	97,174,955 - 97,216,585 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	97,174,916 - 97,216,574 (+)	Ensembl				GRCr8
mRatBN7.2	6	91,439,094 - 91,486,139 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	91,438,834 - 91,480,697 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	91,813,295 - 91,850,303 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	92,112,780 - 92,149,786 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	91,540,724 - 91,577,731 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	94,433,658 - 94,484,979 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	94,429,068 - 94,484,351 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	103,874,809 - 103,935,598 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	95,162,067 - 95,198,936 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	89,903,080 - 89,939,925 (+)	NCBI		Celera
RGSC_v3.1	6	95,165,522 - 95,202,392 (+)	NCBI
Cytogenetic Map	6	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-amino-2-deoxy-D-glucopyranose (ISO)

2-methylcholine (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

acrylamide (EXP)

actinomycin D (ISO)

aflatoxin B1 (ISO)

aldehydo-D-glucosamine (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

ammonium chloride (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

beta-D-glucosamine (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

bortezomib (ISO)

butanal (ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

choline (ISO)

chrysene (ISO)

cisplatin (ISO)

clofibrate (ISO)

clozapine (EXP)

copper atom (ISO)

copper(0) (ISO)

coumestrol (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

dioxygen (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

ethyl methanesulfonate (ISO)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

gentamycin (EXP)

glafenine (EXP)

glyphosate (ISO)

GSK-J4 (ISO)

haloperidol (EXP)

ivermectin (ISO)

L-methionine (ISO)

leflunomide (ISO)

methimazole (EXP)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

mono(2-ethylhexyl) phthalate (ISO)

N-acetyl-L-cysteine (ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

nickel atom (ISO)

Nutlin-3 (ISO)

oxaliplatin (EXP)

ozone (EXP,ISO)

panobinostat (ISO)

paracetamol (ISO)

pentachlorophenol (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

propiconazole (ISO)

resveratrol (ISO)

roflumilast (ISO)

rotenone (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

tamoxifen (ISO)

testosterone enanthate (ISO)

thapsigargin (ISO)

titanium dioxide (ISO)

topotecan (EXP)

trichloroethene (EXP,ISO)

trichostatin A (ISO)

triticonazole (EXP)

urethane (ISO)

valproic acid (ISO)

vincristine (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to transforming growth factor beta stimulus (ISO)

N-terminal protein myristoylation (ISO,ISS)

negative regulation of BMP signaling pathway (ISO)

negative regulation of canonical NF-kappaB signal transduction (IEA,ISO,ISS)

negative regulation of non-canonical NF-kappaB signal transduction (IEA,ISO,ISS)

negative regulation of transforming growth factor beta receptor signaling pathway (IEA,ISO)

positive regulation of canonical NF-kappaB signal transduction (ISO)

positive regulation of canonical Wnt signaling pathway (IBA,IEA,ISO)

positive regulation of DNA-templated transcription (IEA,ISO)

positive regulation of protein export from nucleus (ISO)

protein dephosphorylation (ISO,ISS)

regulation of canonical NF-kappaB signal transduction (IBA)

Cellular Component

cytosol (IBA,IEA,ISO,ISS)

membrane (IEA,ISO,ISS)

neuron projection (IDA)

nucleus (IBA,IEA,ISO)

Molecular Function

calmodulin-dependent protein phosphatase activity (IEA,ISO)

cation binding (IEA)

hydrolase activity (IEA)

magnesium ion binding (IEA)

manganese ion binding (IEA)

metal ion binding (IEA)

phosphoprotein phosphatase activity (IDA,IEA,ISO)

protein binding (IPI,ISO)

protein serine/threonine phosphatase activity (IBA,IEA,ISO)

R-SMAD binding (IEA,ISO,ISS)

transmembrane transporter binding (IDA)

Molecular Pathway Annotations Click to see Annotation Detail View

Bone morphogenetic proteins signaling pathway (ISO)

mitogen activated protein kinase signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	A protein phosphatase 2calpha-Ca2+ channel complex for dephosphorylation of neuronal Ca2+ channels phosphorylated by protein kinase C.	Li D, etal., J Neurosci. 2005 Feb 23;25(8):1914-23.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Mutational analysis of Ca(2+)/calmodulin-dependent protein kinase phosphatase (CaMKP).	Tada Y, etal., Arch Biochem Biophys. 2006 Aug 15;452(2):174-85. Epub 2006 Jun 21.
12.	Molecular cloning of rat type 2C (IA) protein phosphatase mRNA.	Tamura S, etal., Proc Natl Acad Sci U S A 1989 Mar;86(6):1796-800.

Additional References at PubMed

PMID:10644691	PMID:11559703	PMID:12477932	PMID:12761501	PMID:14654243	PMID:14664809	PMID:14674259	PMID:16751101	PMID:18930133	PMID:20801214	PMID:21151953	PMID:21829547
PMID:22019086	PMID:22384250	PMID:22926646	PMID:23088624	PMID:25100727

Genomics

Comparative Map Data

Ppm1a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	97,174,955 - 97,216,585 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	97,174,916 - 97,216,574 (+)	Ensembl				GRCr8
mRatBN7.2	6	91,439,094 - 91,486,139 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	91,438,834 - 91,480,697 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	91,813,295 - 91,850,303 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	92,112,780 - 92,149,786 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	91,540,724 - 91,577,731 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	94,433,658 - 94,484,979 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	94,429,068 - 94,484,351 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	103,874,809 - 103,935,598 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	95,162,067 - 95,198,936 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	89,903,080 - 89,939,925 (+)	NCBI		Celera
RGSC_v3.1	6	95,165,522 - 95,202,392 (+)	NCBI
Cytogenetic Map	6	q24	NCBI

PPM1A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	60,245,750 - 60,299,087 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	60,245,752 - 60,299,089 (+)	Ensembl			hg38	GRCh38
GRCh37	14	60,712,468 - 60,765,805 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	59,782,223 - 59,829,826 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	14	59,782,222 - 59,829,823	NCBI
Celera	14	40,762,274 - 40,815,941 (+)	NCBI		Celera
Cytogenetic Map	14	q23.1	NCBI
HuRef	14	40,876,613 - 40,929,690 (+)	NCBI		HuRef
CHM1_1	14	60,651,750 - 60,705,118 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	54,452,043 - 54,505,381 (+)	NCBI		T2T-CHM13v2.0

Ppm1a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	72,804,231 - 72,846,593 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	72,804,229 - 72,846,593 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	12	72,761,211 - 72,799,819 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	72,757,455 - 72,799,819 (+)	Ensembl			mm10	GRCm38
MGSCv37	12	73,862,198 - 73,895,927 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	12	73,680,442 - 73,713,400 (+)	NCBI		MGSCv36	mm8
Celera	12	73,877,430 - 73,911,618 (+)	NCBI		Celera
Cytogenetic Map	12	C3	NCBI
cM Map	12	30.26	NCBI

Ppm1a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955466	9,315,227 - 9,362,028 (-)	Ensembl
ChiLan1.0	NW_004955466	9,315,227 - 9,331,213 (-)	NCBI	ChiLan1.0	ChiLan1.0

PPM1A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	61,383,205 - 61,436,054 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	60,599,719 - 60,650,493 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	40,853,227 - 40,906,044 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	59,117,020 - 59,169,524 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	59,117,020 - 59,162,928 (+)	Ensembl			panPan2	panpan1.1

PPM1A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	35,336,055 - 35,384,249 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	35,336,140 - 35,377,551 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	35,089,958 - 35,138,127 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	35,569,192 - 35,617,610 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	35,569,135 - 35,612,853 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	35,181,328 - 35,229,483 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	35,258,261 - 35,306,410 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	35,618,239 - 35,666,378 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ppm1a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	69,633,876 - 69,685,180 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936495	4,542,464 - 4,553,944 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936495	4,542,576 - 4,560,603 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PPM1A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	189,207,577 - 189,291,345 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	1	189,248,974 - 189,296,147 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	210,387,426 - 210,406,136 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PPM1A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	37,474,371 - 37,522,956 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	37,506,914 - 37,516,414 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666053	25,721,273 - 25,769,924 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ppm1a
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	7	87,030,936 - 87,069,267 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ppm1a
132 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	57
Count of miRNA genes:	44
Interacting mature miRNAs:	55
Transcripts:	ENSRNOT00000008238
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	71278722	116278722	Rat
70176	Mcsm1	Mammary carcinoma susceptibility modifier QTL 1			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	64367996	109367996	Rat
2293088	Iddm28	Insulin dependent diabetes mellitus QTL 28	5.21		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	6	68767270	135411972	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	88019181	136741135	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	93560258	136550638	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	90871046	135871046	Rat
724524	Uae2	Urinary albumin excretion QTL 2	2.7	0.0005	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	79198463	144254945	Rat
4889933	Bss88	Bone structure and strength QTL 88	3.8		tibia size trait (VT:0100001)	tibia total bone volume (CMO:0001724)	6	53684921	98684921	Rat
737827	Hcar11	Hepatocarcinoma resistance QTL 11	4.4		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	6	46050607	116278722	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	93778632	138778632	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	20859430	113082285	Rat
2293837	Kiddil1	Kidney dilation QTL 1	3.7		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	86867923	110125012	Rat
2293842	Kiddil3	Kidney dilation QTL 3	4.3		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	86867923	110125012	Rat
61329	Eae9	Experimental allergic encephalomyelitis QTL 9	3.7		body mass (VT:0001259)	change in body weight (CMO:0002045)	6	84490437	129490437	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	90871046	135871046	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	93560258	136550638	Rat
5684963	Bss99	Bone structure and strength QTL 99	3.1		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	6	53684921	98684921	Rat
1576302	Schws4	Schwannoma susceptibility QTL 4		0.0078	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	78204640	123204640	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	93560258	136550638	Rat
5684992	Bmd83	Bone mineral density QTL 82	4.8		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	6	53684921	98684921	Rat
1300075	Glom7	Glomerulus QTL 7	5.6	0.0000002	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	6	76937178	121937178	Rat
1331789	Rf37	Renal function QTL 37	3.224		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	86494122	112380234	Rat

Markers in Region

D6Arb18

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	91,478,956 - 91,480,045 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	94,483,226 - 94,484,314	NCBI	Rnor6.0
Rnor_5.0	6	103,928,416 - 103,929,504	UniSTS	Rnor5.0
RGSC_v3.4	6	95,197,641 - 95,198,729	UniSTS	RGSC3.4
Celera	6	89,938,630 - 89,939,718	UniSTS
Cytogenetic Map	6	q24	UniSTS

RH144473

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	91,471,814 - 91,472,005 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	94,476,084 - 94,476,274	NCBI	Rnor6.0
Rnor_5.0	6	103,921,274 - 103,921,464	UniSTS	Rnor5.0
RGSC_v3.4	6	95,190,499 - 95,190,689	UniSTS	RGSC3.4
Celera	6	89,931,492 - 89,931,682	UniSTS
RH 3.4 Map	6	663.0	UniSTS
Cytogenetic Map	6	q24	UniSTS

RH140124

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	91,479,743 - 91,479,945 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	94,484,013 - 94,484,214	NCBI	Rnor6.0
Rnor_5.0	6	103,929,203 - 103,929,404	UniSTS	Rnor5.0
RGSC_v3.4	6	95,198,428 - 95,198,629	UniSTS	RGSC3.4
Celera	6	89,939,417 - 89,939,618	UniSTS
RH 3.4 Map	6	658.9	UniSTS
Cytogenetic Map	6	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017038	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017594034	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039111786	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039111787	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063261552	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC097333	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J04503	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000008238 ⟹ ENSRNOP00000008238

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	97,174,916 - 97,216,574 (+)	Ensembl
mRatBN7.2 Ensembl	6	91,438,834 - 91,480,697 (+)	Ensembl
Rnor_6.0 Ensembl	6	94,429,068 - 94,484,351 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000131632 ⟹ ENSRNOP00000103994

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	97,174,916 - 97,216,574 (+)	Ensembl

RefSeq Acc Id:

NM_017038 ⟹ NP_058734

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	97,179,143 - 97,216,129 (+)	NCBI
mRatBN7.2	6	91,443,266 - 91,480,252 (+)	NCBI
Rnor_6.0	6	94,433,661 - 94,484,521 (+)	NCBI
Rnor_5.0	6	103,874,809 - 103,935,598 (+)	NCBI
RGSC_v3.4	6	95,162,067 - 95,198,936 (+)	RGD
Celera	6	89,903,080 - 89,939,925 (+)	RGD

Sequence:

show sequence

TGCCCGGCCGCCGTCGCCACCGCCGCCCCGGCCGACCGAGGGACCCGCCCGCCCGCGGCTGCTC
CGGATCTAGAGGATCAAGTCATAATGGGAGCATTTTTAGACAAGCCAAAGATGGAAAAGCATAA
TGCCCAGGGCCAGGGGAACGGGTTGCGATACGGCCTAAGCAGCATGCAAGGTTGGCGAGTTGAA
ATGGAGGATGCACATACGGCTGTGATCGGTTTGCCAAGTGGACTTGAGACATGGTCATTCTTTG
CTGTATATGATGGGCATGCTGGTTCTCAGGTTGCCAAATACTGCTGTGAGCACTTGTTAGATCA
CATCACCAATAACCAGGATTTTAAAGGCTCTGCAGGAGCACCCTCTGTGGAAAACGTAAAGAAC
GGAATCAGAACAGGTTTTCTGGAGATTGATGAACACATGAGAGTTATGTCAGAGAAGAAACACG
GTGCAGATAGAAGTGGGTCAACAGCTGTGGGTGTCTTAATTTCTCCCCAACATACTTATTTCAT
TAACTGTGGGGACTCAAGAGGTTTACTTTGTAGAAATAGAAAAGTTCACTTCTTCACTCAAGAC
CATAAACCAAGTAATCCTCTGGAAAAAGAACGAATTCAGAATGCAGGGGGCTCTGTGATGATTC
AGCGTGTCAATGGCTCTCTGGCTGTATCAAGAGCTCTTGGGGATTTTGATTACAAATGTGTCCA
TGGAAAAGGTCCCACAGAGCAGCTTGTCTCGCCAGAGCCTGAAGTCCATGATATTGAAAGGTCT
GAAGAAGATGACCAGTTCATCATTCTTGCATGTGATGGCATCTGGGACGTCATGGGCAACGAAG
AGCTCTGTGACTTTGTGAGATCCAGACTTGAAGTCACTGATGACCTTGAGAAAGTTTGCAATGA
AGTAGTCGACACCTGTTTGTATAAGGGAAGTCGAGACAACATGAGTGTGATTTTGATCTGCTTT
CCAAACGCGCCTAAAGTCTCAGCAGAGGCGGTGAAGAAGGAGGCAGAGCTGGACAAGTACCTGG
AGAACAGAGTAGAAGAAATCATAAAGAAGCAGGGGGAAGGCGTCCCTGACTTAGTCCATGTGAT
GCGCACGTTAGCCAGTGAGAACATCCCCAGCCTCCCACCAGGGGGTGAACTGGCAAGCAAGCGG
AATGTAATTGAAGCCGTTTACAATAGACTGAACCCTTACAAAAACGACGACACTGATTCTGCGT
CAACTGATGATATGTGGTAAAGCTGCTCATCTAGCCATGGTTTCACCTTTGCCTGGAAGAGAGA
GAGAGATCAGCGCATCCTTGCTGAGCCTTTAACATCCATCACCGACTTAAGGAAGGGGTCCGAC
ATGGGTGAGGGACTACAGCTTCAGCGATGGAACAGCCAGCCCAGAATGGATTTTTTTTTTTATT
GTAAATTTGAGACTTATGTAAGCGTGATTTCAAACCGTAATTCATGTTGTAAATCAGACTCCAG
CAATTTTTGTTGTATGATTTTGGTTTTTTGTAAAGTGTAATTGTCCTTGTACAAAGTGCTCATA
TTTAATTATGAACTGCTTTAAAATCACTATCAATGATAAAGGAAATTTGGCTTGTTGTGTGGCA
CA

hide sequence

RefSeq Acc Id:

XM_039111786 ⟹ XP_038967714

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	97,174,955 - 97,216,585 (+)	NCBI
mRatBN7.2	6	91,439,094 - 91,486,139 (+)	NCBI

RefSeq Acc Id:

XM_039111787 ⟹ XP_038967715

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	97,201,872 - 97,216,585 (+)	NCBI
mRatBN7.2	6	91,465,994 - 91,486,139 (+)	NCBI

RefSeq Acc Id:

XM_063261552 ⟹ XP_063117622

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	97,201,852 - 97,216,585 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_058734	(Get FASTA)	NCBI Sequence Viewer
	XP_038967714	(Get FASTA)	NCBI Sequence Viewer
	XP_038967715	(Get FASTA)	NCBI Sequence Viewer
	XP_063117622	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41917	(Get FASTA)	NCBI Sequence Viewer
	AAH97333	(Get FASTA)	NCBI Sequence Viewer
	EDM03598	(Get FASTA)	NCBI Sequence Viewer
	EDM03599	(Get FASTA)	NCBI Sequence Viewer
	EDM03600	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000008238
	ENSRNOP00000103994
GenBank Protein	P20650	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_058734 ⟸ NM_017038

- UniProtKB:

P20650 (UniProtKB/Swiss-Prot), A6HC44 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLETWSFFAVYDGHAG
SQVAKYCCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGST
AVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLA
VSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRS
RLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSAEAVKKEAELDKYLENRVEEII
KKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRLNPYKNDDTDSASTDDMW

hide sequence

Ensembl Acc Id:

ENSRNOP00000008238 ⟸ ENSRNOT00000008238

RefSeq Acc Id:	XP_038967714 ⟸ XM_039111786
- Peptide Label:	isoform X1
- UniProtKB:	A0A0H2UHE5 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038967715 ⟸ XM_039111787
- Peptide Label:	isoform X3
- UniProtKB:	P20650 (UniProtKB/Swiss-Prot), A6HC44 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063117622 ⟸ XM_063261552
- Peptide Label:	isoform X2

Ensembl Acc Id:

ENSRNOP00000103994 ⟸ ENSRNOT00000131632

Protein Domains

PPM-type phosphatase Protein serine/threonine phosphatase 2C C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P20650-F1-model_v2	AlphaFold	P20650	1-382	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3373	AgrOrtholog
BioCyc Gene	G2FUF-37132	BioCyc
Ensembl Genes	ENSRNOG00000005916	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000008238	ENTREZGENE
	ENSRNOT00000131632	ENTREZGENE
Gene3D-CATH	1.10.10.430	UniProtKB/Swiss-Prot
	3.60.40.10	UniProtKB/Swiss-Prot
InterPro	PP2C	UniProtKB/Swiss-Prot
	PP2C_BS	UniProtKB/Swiss-Prot
	PP2C_C	UniProtKB/Swiss-Prot
	PP2C_C_sf	UniProtKB/Swiss-Prot
	PPM-type_dom_sf	UniProtKB/Swiss-Prot
	PPM-type_phosphatase_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:24666	UniProtKB/Swiss-Prot
NCBI Gene	24666	ENTREZGENE
PANTHER	PROTEIN PHOSPHATASE	UniProtKB/Swiss-Prot
Pfam	PP2C	UniProtKB/Swiss-Prot
	PP2C_C	UniProtKB/Swiss-Prot
PhenoGen	Ppm1a	PhenoGen
PROSITE	PPM_1	UniProtKB/Swiss-Prot
	PPM_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000005916	RatGTEx
SMART	PP2Cc	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF81601	UniProtKB/Swiss-Prot
	SSF81606	UniProtKB/Swiss-Prot
UniProt	A0A0H2UHE5	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LF00_RAT	UniProtKB/TrEMBL
	A6HC44	ENTREZGENE, UniProtKB/TrEMBL
	A6HC45_RAT	UniProtKB/TrEMBL
	P20650	ENTREZGENE, UniProtKB/Swiss-Prot
	Q4V8L2_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-05-03	Ppm1a	protein phosphatase, Mg2+/Mn2+ dependent, 1A	Ppm1a	protein phosphatase 1A, magnesium dependent, alpha isoform	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Ppm1a	Protein phosphatase type 1A (formely 2C), Mg-dependent, alpha isoform			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_regulation	requires Mg2+ for activity	729446

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)