Advanced Search (OLGA)

Gene: Nedd8 (NEDD8 ubiquitin like modifier) Rattus norvegicus

Analyze

Symbol:

Nedd8

Name:

NEDD8 ubiquitin like modifier

RGD ID:

3158

Description:

Predicted to enable protein tag activity and ubiquitin protein ligase binding activity. Involved in cellular response to camptothecin and protein neddylation. Is active in postsynapse. Orthologous to human NEDD8 (NEDD8 ubiquitin like modifier); PARTICIPATES IN neddylation pathway; p53 signaling pathway; proteasome degradation pathway involving cullin-dependent ubiquitin ligases; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

CDK8; MGC105320; neddylin; neural precursor cell expressed, developmentally down-regulated 8; neural precursor cell expressed, developmentally down-regulated gene 8; ubiquitin-like protein Nedd8

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NEDD8 (NEDD8 ubiquitin like modifier)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Nedd8 (neural precursor cell expressed, developmentally down-regulated gene 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nedd8 (NEDD8 ubiquitin like modifier)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NEDD8 (NEDD8 ubiquitin like modifier)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NEDD8 (NEDD8 ubiquitin like modifier)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nedd8 (NEDD8 ubiquitin like modifier)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NEDD8 (NEDD8 ubiquitin like modifier)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NEDD8 (NEDD8 ubiquitin like modifier)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nedd8 (NEDD8 ubiquitin like modifier)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Nedd8 (NEDD8 ubiquitin like modifier)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Nedd8 (neural precursor cell expressed, developmentally down-regulated gene 8)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	NEDD8 (NEDD8 ubiquitin like modifier)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nedd8l (neural precursor cell expressed, developmentally down-regulated 8, like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nedd8l (neural precursor cell expressed, developmentally down-regulated 8, like)	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	nedd8 (neural precursor cell expressed, developmentally down-regulated 8)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ned-8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ned-8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Nedd8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RUB1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	nedd8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	33,123,505 - 33,135,522 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	33,123,505 - 33,135,522 (-)	Ensembl				GRCr8
mRatBN7.2	15	29,153,556 - 29,165,575 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	29,153,556 - 29,166,160 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	15	30,999,240 - 31,011,260 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	32,146,461 - 32,158,481 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	30,388,805 - 30,400,824 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	34,340,607 - 34,352,673 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	34,340,607 - 34,352,673 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	15	38,230,806 - 38,242,650 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	33,797,457 - 33,820,624 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	28,729,741 - 28,741,968 (-)	NCBI		Celera
RGSC_v3.1	15	33,813,156 - 33,836,123 (-)	NCBI
Cytogenetic Map	15	p13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

alcohol-associated liver disease (ISO)

malignant astrocytoma (ISO)

Parkinson's disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dinitrotoluene (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

6-propyl-2-thiouracil (EXP)

acetohydrazide (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

ammonium chloride (EXP)

arsenite(3-) (ISO)

arsenous acid (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

Benzo[ghi]perylene (ISO)

beryllium sulfate (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

Bufotalin (ISO)

cadmium atom (ISO)

CGP 52608 (ISO)

chloropicrin (ISO)

chlorpyrifos (ISO)

clofibric acid (EXP)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (ISO)

dieldrin (EXP)

elemental selenium (ISO)

flutamide (EXP)

folic acid (ISO)

indometacin (ISO)

ivermectin (ISO)

methimazole (EXP)

nimesulide (EXP)

nitrates (ISO)

pirinixic acid (ISO)

propiconazole (EXP)

quercetin (ISO)

selenium atom (ISO)

sodium arsenite (EXP,ISO)

sulfadimethoxine (EXP)

tetrachloromethane (ISO)

triphenyl phosphate (ISO)

tungsten (ISO)

vitamin E (ISO)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to camptothecin (IDA)

intracellular protein localization (ISO)

modification-dependent protein catabolic process (IBA)

protein neddylation (IBA,IDA,ISO)

protein ubiquitination (IBA)

regulation of postsynapse assembly (IEA,ISO)

regulation of proteolysis (IBA)

regulation of transcription by RNA polymerase II (ISO)

Cellular Component

cytoplasm (IBA)

glutamatergic synapse (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA,IEA,ISO)

postsynapse (IDA)

Molecular Function

protein binding (IPI,ISO)

protein tag activity (IBA)

ubiquitin protein ligase binding (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

neddylation pathway (ISS)

p53 signaling pathway (ISO)

proteasome degradation pathway involving cullin-dependent ubiquitin ligases (ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Synaptic control of DNA methylation involves activity-dependent degradation of DNMT3A1 in the nucleus.	Bayraktar G, etal., Neuropsychopharmacology. 2020 Nov;45(12):2120-2130. doi: 10.1038/s41386-020-0780-2. Epub 2020 Jul 29.
2.	Expression of VACM-1/cul5 mutant in endothelial cells induces MAPK phosphorylation and maspin degradation and converts cells to the angiogenic phenotype.	Buchwalter A, etal., Microvasc Res. 2008 Mar;75(2):155-68. Epub 2007 Sep 4.
3.	APP-BP1 mediates APP-induced apoptosis and DNA synthesis and is increased in Alzheimer's disease brain.	Chen Y, etal., J Cell Biol. 2003 Oct 13;163(1):27-33.
4.	Cullin-based ubiquitin ligase and its control by NEDD8-conjugating system.	Chiba T and Tanaka K, Curr Protein Pept Sci 2004 Jun;5(3):177-84.
5.	NEDD8 protein is involved in ubiquitinated inclusion bodies.	Dil Kuazi A, etal., J Pathol 2003 Feb;199(2):259-66.
6.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
8.	Comparative expressed-sequence-tag analysis of differential gene expression profiles in PC-12 cells before and after nerve growth factor treatment.	Lee NH, etal., Proc Natl Acad Sci U S A 1995 Aug 29;92(18):8303-7.
9.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
10.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
12.	GOA pipeline	RGD automated data pipeline
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	C terminus of Hsc70-interacting protein (CHIP)-mediated degradation of hippocampal estrogen receptor-alpha and the critical period hypothesis of estrogen neuroprotection.	Zhang QG, etal., Proc Natl Acad Sci U S A. 2011 Aug 30;108(35):E617-24. doi: 10.1073/pnas.1104391108. Epub 2011 Aug 1.

Additional References at PubMed

PMID:9125149	PMID:10500095	PMID:12215427	PMID:12477932	PMID:15489334	PMID:15694336	PMID:20458337	PMID:22871113	PMID:23376485

Genomics

Comparative Map Data

Nedd8
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	33,123,505 - 33,135,522 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	33,123,505 - 33,135,522 (-)	Ensembl				GRCr8
mRatBN7.2	15	29,153,556 - 29,165,575 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	29,153,556 - 29,166,160 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	15	30,999,240 - 31,011,260 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	32,146,461 - 32,158,481 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	30,388,805 - 30,400,824 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	34,340,607 - 34,352,673 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	34,340,607 - 34,352,673 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	15	38,230,806 - 38,242,650 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	33,797,457 - 33,820,624 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	28,729,741 - 28,741,968 (-)	NCBI		Celera
RGSC_v3.1	15	33,813,156 - 33,836,123 (-)	NCBI
Cytogenetic Map	15	p13	NCBI

NEDD8
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	24,216,857 - 24,232,367 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	24,216,802 - 24,232,385 (-)	Ensembl			hg38	GRCh38
GRCh37	14	24,686,063 - 24,701,573 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	23,755,897 - 23,771,416 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	14	23,755,911 - 23,771,412	NCBI
Celera	14	4,550,695 - 4,566,214 (-)	NCBI		Celera
Cytogenetic Map	14	q12	NCBI
HuRef	14	4,801,062 - 4,816,345 (-)	NCBI		HuRef
CHM1_1	14	24,684,707 - 24,700,199 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	14	18,415,233 - 18,430,739 (-)	NCBI		T2T-CHM13v2.0

Nedd8
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	55,899,720 - 55,909,337 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	55,899,720 - 55,909,581 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	14	55,662,263 - 55,671,880 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	55,662,263 - 55,672,124 (-)	Ensembl			mm10	GRCm38
MGSCv37	14	56,281,104 - 56,290,743 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	14	54,616,338 - 54,625,977 (-)	NCBI		MGSCv36	mm8
Celera	14	53,467,340 - 53,476,979 (-)	NCBI		Celera
Cytogenetic Map	14	C3	NCBI
cM Map	14	28.19	NCBI

Nedd8
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955409	36,173,533 - 36,182,444 (+)	Ensembl
ChiLan1.0	NW_004955409	36,173,533 - 36,182,444 (+)	NCBI	ChiLan1.0	ChiLan1.0

NEDD8
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	25,571,077 - 25,586,644 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	24,787,569 - 24,803,136 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	4,993,011 - 5,008,620 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	23,117,271 - 23,132,249 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	23,117,271 - 23,132,249 (-)	Ensembl			panPan2	panpan1.1

NEDD8
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	4,202,621 - 4,213,090 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	4,202,621 - 4,213,049 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	4,124,303 - 4,134,768 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	4,313,388 - 4,323,857 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	4,313,388 - 4,323,818 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	4,003,790 - 4,014,244 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	4,065,590 - 4,076,046 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	4,327,911 - 4,338,370 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Nedd8
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	36,050,496 - 36,058,043 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936722	331,136 - 338,496 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936722	331,116 - 338,496 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NEDD8
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	75,070,161 - 75,085,899 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	75,069,947 - 75,085,905 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	80,340,870 - 80,353,291 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NEDD8
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	1,199,974 - 1,215,079 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666036	12,884,384 - 12,899,520 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nedd8
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624820	8,319,832 - 8,329,748 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624820	8,319,763 - 8,329,748 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Nedd8
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	12	69,333,015 - 69,344,880 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Nedd8
69 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	48
Count of miRNA genes:	40
Interacting mature miRNAs:	47
Transcripts:	ENSRNOT00000064916
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1641913	Colcr2	Colorectal carcinoma resistance QTL 2	6.57	0.0197	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	15	2315759	47315759	Rat
5684946	Bss98	Bone structure and strength QTL 98	3.9	0.0026	tibia strength trait (VT:1000284)	tibia ultimate force (CMO:0001734)	15	1	39411584	Rat
1641887	Alcrsp14	Alcohol response QTL 14			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	15	1	44836456	Rat
738017	Hcas7	Hepatocarcinoma susceptibility QTL 7	2.91		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	15	2315759	53331089	Rat
152025253	Hrtrt24	Heart rate QTL 24	3.82		heart pumping trait (VT:2000009)		15	31855803	92671517	Rat
10755503	Bp391	Blood pressure QTL 391	2.37		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	15	22728353	42072050	Rat
10054130	Srcrt8	Stress Responsive Cort QTL 8	2.18	0.0085	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	15	28527732	73527732	Rat
1578646	Bmd18	Bone mineral density QTL 18	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	15	25285835	104695021	Rat
2324620	Coatc3	Coat color QTL 3			coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	15	22336351	52597086	Rat
1578647	Bmd17	Bone mineral density QTL 17	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	15	25285835	104695021	Rat
61424	Scl1	Serum cholesterol level QTL 1	7.7	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	15	19155762	87086765	Rat
10401805	Kidm51	Kidney mass QTL 51			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	15	2785923	47785923	Rat
2317750	Glom26	Glomerulus QTL 26	4.3		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	15	14926594	71614418	Rat
631550	Bw7	Body weight QTL 7	3.6		body mass (VT:0001259)	body weight (CMO:0000012)	15	22336351	67336351	Rat
1578660	Bss19	Bone structure and strength QTL 19	4.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	15	25285835	104695021	Rat

Markers in Region

RH129220

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	29,153,591 - 29,153,782 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	34,340,643 - 34,340,833	NCBI	Rnor6.0
Rnor_5.0	15	38,230,842 - 38,231,032	UniSTS	Rnor5.0
RGSC_v3.4	15	33,797,493 - 33,797,683	UniSTS	RGSC3.4
Celera	15	28,729,777 - 28,729,967	UniSTS
Cytogenetic Map	15	p13	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_138878	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC116083	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF095740	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC084728	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB581170	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474049	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230524	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X89819	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000064916 ⟹ ENSRNOP00000061284

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	15	33,123,505 - 33,135,522 (-)	Ensembl
mRatBN7.2 Ensembl	15	29,153,557 - 29,165,611 (-)	Ensembl
Rnor_6.0 Ensembl	15	34,340,607 - 34,352,673 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000080232 ⟹ ENSRNOP00000073032

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	15	34,340,872 - 34,342,373 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104192 ⟹ ENSRNOP00000091841

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	29,153,556 - 29,166,160 (-)	Ensembl

RefSeq Acc Id:

NM_138878 ⟹ NP_620233

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	33,123,505 - 33,135,522 (-)	NCBI
mRatBN7.2	15	29,153,556 - 29,165,575 (-)	NCBI
Rnor_6.0	15	34,340,607 - 34,352,673 (-)	NCBI
Rnor_5.0	15	38,230,806 - 38,242,650 (-)	NCBI
RGSC_v3.4	15	33,797,457 - 33,820,624 (-)	RGD
Celera	15	28,729,741 - 28,741,968 (-)	RGD

Sequence:

show sequence

GACACGTGCGGGGTCTCAGGTGTCGTCTGGCTCTTCCTAAATCGGTTTTCCTTTCTCTTTACAA
CCCAACTGACACAAAATCCGAGGGCACTCCTGAGCGTTTCGGGAACCGGCTGGAAAGAGGAGCG
GGTGGGTCCGGAGAGTGACCCGGAAGCAGAAGTGTTCCTCGCCGTGGAGTGCTGGGAAGCGGCA
GCGGCAGTAGCGACCACAGCGGGAGAAGCAGCACTCTAGCCGCCTGTAACCCCAACCTGGGAGG
AAGATGCTAATTAAAGTGAAGACGCTGACTGGAAAGGAGATTGAGATTGACATCGAACCCACAG
ACAAGGTGGAACGAATCAAGGAGCGTGTGGAAGAAAAAGAAGGAATTCCCCCACAACAGCAGCG
GCTCATCTACAGTGGCAAACAAATGAATGATGAGAAGACAGCAGCTGATTACAAGATTCTAGGT
GGTTCCGTCCTCCACCTGGTGTTGGCTCTTAGAGGAGGTGGTGGTCTTGGGCAATGAAGAAACT
TGATTCTGTTTTACCTCCTTGTCCTGCCGCTCATAATGTGGCATCACATATCCTCTCACTCTCT
GGGACACCAGAGCTACTGCCCCCTTCCTTGGATGCCCAATCTTGTGTGTCTACTGGTGGGAGAA
TGTGAGGACCCCAGGATGCAGTGTTCCTGGCCCAAATGGCCCTTGCTGGCCATTGGGTTTTAGT
TTGCAGTCCTGTGTGCTTCCCTCTCTTATGGCTATATCCTTGGTTGTCAATAAAATATTTCCTG
GCAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_620233	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC64189	(Get FASTA)	NCBI Sequence Viewer
	AAH84728	(Get FASTA)	NCBI Sequence Viewer
	EDM14262	(Get FASTA)	NCBI Sequence Viewer
	EDM14263	(Get FASTA)	NCBI Sequence Viewer
	EDM14264	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000061284
	ENSRNOP00000061284.1
GenBank Protein	Q71UE8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_620233 ⟸ NM_138878
- UniProtKB:	Q71UE8 (UniProtKB/Swiss-Prot), A6KH34 (UniProtKB/TrEMBL), A0A8I6AG01 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGG SVLHLVLALRGGGGLGQ hide sequence

Ensembl Acc Id:

ENSRNOP00000073032 ⟸ ENSRNOT00000080232

Ensembl Acc Id:

ENSRNOP00000061284 ⟸ ENSRNOT00000064916

Ensembl Acc Id:

ENSRNOP00000091841 ⟸ ENSRNOT00000104192

Protein Domains

Ubiquitin-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q71UE8-F1-model_v2	AlphaFold	Q71UE8	1-81	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699681

Promoter ID:

EPDNEW_R10204

Type:

initiation region

Name:

Nedd8_1

Description:

neural precursor cell expressed, developmentally down-regulated8

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R10205

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	15	34,352,482 - 34,352,542	EPDNEW

RGD ID:

13699682

Promoter ID:

EPDNEW_R10205

Type:

initiation region

Name:

Nedd8_2

Description:

neural precursor cell expressed, developmentally down-regulated8

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R10204

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	15	34,352,714 - 34,352,774	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3158	AgrOrtholog
BioCyc Gene	G2FUF-13699	BioCyc
Ensembl Genes	ENSRNOG00000019895	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000064916	ENTREZGENE
	ENSRNOT00000064916.3	UniProtKB/Swiss-Prot
Gene3D-CATH	Phosphatidylinositol 3-kinase Catalytic Subunit, Chain A, domain 1	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7315541	IMAGE-MGC_LOAD
InterPro	Nedd8-like	UniProtKB/Swiss-Prot
	Ubiquitin	UniProtKB/Swiss-Prot
	Ubiquitin-like_domsf	UniProtKB/Swiss-Prot
	Ubiquitin_CS	UniProtKB/Swiss-Prot
	Ubiquitin_dom	UniProtKB/Swiss-Prot
	Ubiquitin_ubiquitin-like	UniProtKB/Swiss-Prot
KEGG Report	rno:25490	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105320	IMAGE-MGC_LOAD
NCBI Gene	25490	ENTREZGENE
PANTHER	UBIQUITIN	UniProtKB/Swiss-Prot
Pfam	ubiquitin	UniProtKB/Swiss-Prot
PhenoGen	Nedd8	PhenoGen
PRINTS	UBIQUITIN	UniProtKB/Swiss-Prot
PROSITE	UBIQUITIN_1	UniProtKB/Swiss-Prot
	UBIQUITIN_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000019895	RatGTEx
SMART	UBQ	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF54236	UniProtKB/Swiss-Prot
UniProt	A0A8I6AG01	ENTREZGENE
	A6KH33_RAT	UniProtKB/TrEMBL
	A6KH34	ENTREZGENE, UniProtKB/TrEMBL
	NEDD8_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-08-08	Nedd8	NEDD8 ubiquitin like modifier	Nedd8	neural precursor cell expressed, developmentally down-regulated 8	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Nedd8	neural precursor cell expressed, developmentally down-regulated 8	Nedd8	neural precursor cell expressed, developmentally down-regulated gene 8	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Nedd8	Neural precursor cell expressed, developmentally down-regulated gene 8			Symbol and Name status set to approved	70586	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations

Imported Annotations - PID (archival)

Send us a Message

RGD Manual Annotations

Imported Annotations - PID (archival)