Advanced Search (OLGA)

Gene: Slc25a36 (solute carrier family 25 member 36) Rattus norvegicus

Analyze

Symbol:

Slc25a36

Name:

solute carrier family 25 member 36

RGD ID:

1591928

Description:

Predicted to enable pyrimidine nucleotide transmembrane transporter activity. Predicted to be involved in mitochondrion organization; pyrimidine nucleotide import into mitochondrion; and regulation of mitochondrial membrane potential. Predicted to be located in mitochondrial inner membrane. Predicted to be active in mitochondrion. Human ortholog(s) of this gene implicated in familial hyperinsulinemic hypoglycemia 8. Orthologous to human SLC25A36 (solute carrier family 25 member 36); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl; 3,4-methylenedioxymethamphetamine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC501039; similar to solute carrier family 25, member 36; solute carrier family 25 (pyrimidine nucleotide carrier ), member 36; solute carrier family 25, member 36

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SLC25A36 (solute carrier family 25 member 36)	RGD	RGD
Mus musculus (house mouse):	Slc25a36 (solute carrier family 25, member 36)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Slc25a36 (solute carrier family 25 member 36)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SLC25A36 (solute carrier family 25 member 36)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SLC25A36 (solute carrier family 25 member 36)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Slc25a36 (solute carrier family 25 member 36)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SLC25A36 (solute carrier family 25 member 36)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SLC25A36 (solute carrier family 25 member 36)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Slc25a36 (solute carrier family 25 member 36)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Slc25a36 (solute carrier family 25 member 36)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SLC25A33 (solute carrier family 25 member 33)	HGNC	OrthoDB
Alliance orthologs ³
Mus musculus (house mouse):	Slc25a36 (solute carrier family 25, member 36)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Slc25a36 (solute carrier family 25, member 36)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Homo sapiens (human):	SLC25A36 (solute carrier family 25 member 36)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	slc25a36b (solute carrier family 25 member 36b)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	slc25a36a (solute carrier family 25 member 36a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	slc25a36a (solute carrier family 25 member 36a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	T09F3.2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RIM2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Rim2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	slc25a36	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	slc25a36	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	106,539,355 - 106,573,240 (-)	NCBI	GRCr8	GRCr8		GRCr8
mRatBN7.2	8	97,659,848 - 97,693,735 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	97,662,127 - 97,693,703 (-)	Ensembl				mRatBN7.2
Rnor_6.0	8	104,962,569 - 104,995,935 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	104,966,124 - 104,995,725 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	104,408,766 - 104,442,183 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	102,160,470 - 102,191,368 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	97,099,939 - 97,133,771 (-)	NCBI		Celera
Cytogenetic Map	8	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

familial hyperinsulinemic hypoglycemia 8 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-butan-2-yl-4-[4-[4-[4-[[2-(2,4-dichlorophenyl)-2-(1,2,4-triazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy]phenyl]-1-piperazinyl]phenyl]-1,2,4-triazol-3-one (ISO)

2-hydroxypropanoic acid (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,4-methylenedioxymethamphetamine (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

6-propyl-2-thiouracil (EXP)

8-Br-cAMP (ISO)

acrolein (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

alpha-pinene (ISO)

alpha-Zearalanol (EXP)

amitrole (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-naphthoflavone (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

choline (ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

diallyl trisulfide (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

dimethyl sulfoxide (ISO)

dioxygen (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

folic acid (ISO)

formaldehyde (ISO)

gentamycin (EXP)

GSK-J4 (ISO)

indometacin (ISO)

inulin (ISO)

irinotecan (EXP)

itraconazole (ISO)

ketoconazole (ISO)

L-methionine (ISO)

leflunomide (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

menadione (ISO)

mercury dichloride (ISO)

methimazole (EXP)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

N(4)-hydroxycytidine (ISO)

ozone (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

potassium chromate (ISO)

rac-lactic acid (ISO)

SB 431542 (ISO)

selenium atom (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

tetrachloroethene (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

vitamin E (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

nucleotide transport (IEA)

pyrimidine nucleotide import into mitochondrion (IBA,ISO)

pyrimidine nucleotide transport (IEA)

transmembrane transport (IEA)

Cellular Component

membrane (IEA)

mitochondrial inner membrane (IEA)

mitochondrion (IBA,ISO)

Molecular Function

pyrimidine nucleotide transmembrane transporter activity (IBA,IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:18614015	PMID:25320081

Genomics

Comparative Map Data

Slc25a36
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	106,539,355 - 106,573,240 (-)	NCBI	GRCr8	GRCr8		GRCr8
mRatBN7.2	8	97,659,848 - 97,693,735 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	97,662,127 - 97,693,703 (-)	Ensembl				mRatBN7.2
Rnor_6.0	8	104,962,569 - 104,995,935 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	104,966,124 - 104,995,725 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	104,408,766 - 104,442,183 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	102,160,470 - 102,191,368 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	97,099,939 - 97,133,771 (-)	NCBI		Celera
Cytogenetic Map	8	q31	NCBI

SLC25A36
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	140,941,836 - 140,980,995 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	140,941,801 - 140,980,995 (+)	Ensembl			hg38	GRCh38
GRCh37	3	140,660,678 - 140,699,837 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	142,143,352 - 142,181,475 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	3	139,084,063 - 139,122,168 (+)	NCBI		Celera
Cytogenetic Map	3	q23	NCBI
HuRef	3	138,035,327 - 138,073,626 (+)	NCBI		HuRef
CHM1_1	3	140,623,723 - 140,661,797 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	143,689,289 - 143,728,462 (+)	NCBI		T2T-CHM13v2.0

Slc25a36
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	96,957,014 - 96,993,094 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	96,957,014 - 96,993,210 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	9	97,075,281 - 97,111,041 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	97,074,961 - 97,111,157 (-)	Ensembl			mm10	GRCm38
MGSCv37	9	96,977,430 - 97,011,460 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	9	96,886,363 - 96,920,393 (-)	NCBI		MGSCv36	mm8
Celera	9	96,636,632 - 96,670,568 (-)	NCBI		Celera
Cytogenetic Map	9	E3.3	NCBI
cM Map	9	50.84	NCBI

Slc25a36
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955508	4,699,668 - 4,721,199 (-)	Ensembl
ChiLan1.0	NW_004955508	4,699,668 - 4,721,198 (-)	NCBI	ChiLan1.0	ChiLan1.0

SLC25A36
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	138,853,346 - 138,891,560 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	138,858,078 - 138,896,296 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	137,976,619 - 138,014,774 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	145,574,087 - 145,612,175 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	145,585,900 - 145,608,694 (+)	Ensembl			panPan2	panpan1.1

SLC25A36
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	23	36,912,715 - 36,948,757 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	23	36,922,994 - 36,948,975 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	23	36,905,647 - 36,942,342 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	23	37,447,017 - 37,483,948 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	23	37,446,342 - 37,482,141 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	23	37,128,520 - 37,165,905 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	23	37,202,532 - 37,239,616 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	23	37,445,117 - 37,482,302 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Slc25a36
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	76,133,191 - 76,155,331 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936540	2,876,075 - 2,896,074 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936540	2,876,050 - 2,894,061 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SLC25A36
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	81,750,031 - 81,791,891 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	81,750,189 - 81,791,869 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	89,592,343 - 89,630,448 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SLC25A36
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	49,571,378 - 49,636,547 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666041	22,542,818 - 22,582,055 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Slc25a36
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624730	17,589,512 - 17,620,662 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Slc25a36
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	8	88,514,018 - 88,546,173 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Slc25a36
247 total Variants

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	63141536	109261840	Rat
1549909	Stresp11	Stress response QTL 11	6.83	0.0019	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	8	82352698	127352698	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	62848139	107848139	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	62848139	107848139	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	49849908	118871671	Rat
9590292	Uminl3	Urine mineral level QTL 3	3.62	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	8	80768445	125768445	Rat
1331804	Cm30	Cardiac mass QTL 30	3.77443		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	8	62970527	107970527	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	62848139	107848139	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	62848139	107848139	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	62848139	107848139	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	62848139	107848139	Rat
738011	Anxrr9	Anxiety related response QTL 9	6.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	8	102413464	132782436	Rat
71120	Niddm21	Non-insulin dependent diabetes mellitus QTL 21	3.73		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	8	66992095	111992095	Rat
8693654	Alc32	Alcohol consumption QTL 32	2	0.755	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	8	97492344	116428905	Rat
634332	Pia18	Pristane induced arthritis QTL 18	4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	84192326	132782436	Rat
1300171	Bp184	Blood pressure QTL 184	3.66		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	8	79394435	132782436	Rat
2313400	Anxrr25	Anxiety related response QTL 25			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	8	98145073	122898010	Rat
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	105462581	132782436	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	61019838	121662124	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	62848139	107848139	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	63404444	108404444	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	35464071	107982864	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	55428416	107963099	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	62963099	107963099	Rat
8694446	Bw170	Body weight QTL 170	12.07	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	8	80768445	125768445	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	70041301	121080908	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	50763951	107970527	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	68690349	119799881	Rat
10450865	Bw175	Body weight QTL 175	4.1		total fat pad mass (VT:0015008)	adipose tissue molecular composition measurement (CMO:0000484)	8	84192326	129192326	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	35464071	107982864	Rat
724539	Cm19	Cardiac mass QTL 19	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	8	103375781	129871912	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	55428333	127966348	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	39106363	114525825	Rat
2300181	Bmd55	Bone mineral density QTL 55	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	85348065	130348065	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	62848139	107848139	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	35464071	107982864	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	62982864	107982864	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	62848139	107848139	Rat
8694200	Abfw4	Abdominal fat weight QTL 4	9.07	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	8	80768445	125768445	Rat
8694392	Bw161	Body weight QTL 161	8.06	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	8	80768445	125768445	Rat
61437	Cia6	Collagen induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	91340911	131690273	Rat

Markers in Region

RH135209

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	97,691,678 - 97,691,867 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	104,993,881 - 104,994,069	NCBI	Rnor6.0
Rnor_5.0	8	104,440,078 - 104,440,266	UniSTS	Rnor5.0
RGSC_v3.4	8	102,189,534 - 102,189,722	UniSTS	RGSC3.4
Celera	8	97,131,707 - 97,131,895	UniSTS
RH 3.4 Map	8	1051.3	UniSTS
Cytogenetic Map	8	q31	UniSTS

RH142614

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	97,662,319 - 97,662,424 (+)	MAPPER	mRatBN7.2
mRatBN7.2	19	32,939,520 - 32,939,625 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	37,017,337 - 37,017,441	NCBI	Rnor6.0
Rnor_6.0	8	104,965,041 - 104,965,145	NCBI	Rnor6.0
Rnor_5.0	19	47,882,511 - 47,882,615	UniSTS	Rnor5.0
Rnor_5.0	8	104,411,238 - 104,411,342	UniSTS	Rnor5.0
RGSC_v3.4	19	34,876,225 - 34,876,329	UniSTS	RGSC3.4
RGSC_v3.4	8	102,160,175 - 102,160,279	UniSTS	RGSC3.4
Celera	8	97,102,411 - 97,102,515	UniSTS
Celera	19	32,370,424 - 32,370,528	UniSTS
Cytogenetic Map	8	q31	UniSTS

BF399367

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	97,691,287 - 97,691,502 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	104,993,490 - 104,993,704	NCBI	Rnor6.0
Rnor_5.0	8	104,439,687 - 104,439,901	UniSTS	Rnor5.0
RGSC_v3.4	8	102,189,143 - 102,189,357	UniSTS	RGSC3.4
Celera	8	97,131,316 - 97,131,530	UniSTS
RH 3.4 Map	8	1051.3	UniSTS
Cytogenetic Map	8	q31	UniSTS

BF399456

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	97,691,176 - 97,691,352 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	104,993,379 - 104,993,554	NCBI	Rnor6.0
Rnor_5.0	8	104,439,576 - 104,439,751	UniSTS	Rnor5.0
RGSC_v3.4	8	102,189,032 - 102,189,207	UniSTS	RGSC3.4
Celera	8	97,131,205 - 97,131,380	UniSTS
RH 3.4 Map	8	1052.4	UniSTS
Cytogenetic Map	8	q31	UniSTS

UniSTS:547052

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	32,942,189 - 32,943,209 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	37,020,660 - 37,021,840	NCBI	Rnor6.0
Rnor_5.0	19	47,885,859 - 47,887,039	UniSTS	Rnor5.0
Celera	19	32,371,424 - 32,372,443	UniSTS
Cytogenetic Map	8	q31	UniSTS
Cytogenetic Map	19	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001427729	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_001065705	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008757844	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008766577	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082571	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082574	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063265996	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063265997	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_001839507	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_001844742	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_001844743	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000037120 ⟹ ENSRNOP00000033519

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	97,662,127 - 97,693,703 (-)	Ensembl
Rnor_6.0 Ensembl	8	104,966,124 - 104,995,725 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000110158 ⟹ ENSRNOP00000093028

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	97,662,127 - 97,667,087 (-)	Ensembl

RefSeq Acc Id:

NM_001427729 ⟹ NP_001414658

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	106,539,355 - 106,573,203 (-)	NCBI

RefSeq Acc Id:

XM_008766577 ⟹ XP_008764799

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	106,539,355 - 106,573,240 (-)	NCBI
mRatBN7.2	8	97,663,229 - 97,693,734 (-)	NCBI
Rnor_6.0	8	104,965,950 - 104,995,934 (-)	NCBI

Sequence:

show sequence

AGGGACCTCCGACTCCTCACGACTCGCGCTGCGCAGTCCGGCGGAGCTCGCTGGAGCAGGAACC
CAGCGGGGTGGGTTTGCGGGTGGCCATCCGCCGCGGCGGCTCCGCTCACTCCCCGACGTCCCTC
TTCTTGGCCCTCGCCGCTGGCCGTGGCGGCCTGCTGGGTCCGCGTCCCGCCTCTGCTCCCTGAG
GACATGCAGAAGAGAGAATGAGCCAGAGGGACACGCTGGTGCATCTGTTTGCCGGGGGATGTGG
TGGTACAGTGGGAGCTATTCTGACATGTCCACTGGAAGTTGTCAAAACACGACTGCAGTCATCT
TCTGTGACACTATATATTTCTGAAGTTCAGCTGAACACCATGGCTGGAGCCAGTGTCAACCGAG
TAGTGTCCCCTGGACCTCTTCATTGTCTAAAAGCAATATACTTTGCTGCCTATTCAAACTGCAA
GGAAAAGTTGAACGGTGTTTTTGATCCTGACTCTACCCAAGTACACATGATTTCAGCTGCAATG
GCAGGTTTTACTGCGATCACTGCAACAAACCCCATTTGGCTTATAAAGACTCGGCTGCAGCTTG
ATGCAAGGAATCGTGGGGAGAAACGAATGGGTGCTTTTGAATGTGTTCGTAAAGTATATCAGAC
AGACGGACTGAGAGGATTTTATAGGGGCATGTCTGCCTCATATGCTGGCATATCAGAGACAGTT
ATCCATTTTGTTATTTATGAAAGTATAAAGCAAAAGCTACTGGAGTGTAAGACTGCTTCTATGA
TGGAGACTGACGAGGAGTCTGTGAAGGAAGCATCGGATTTTGTGAGAATGATGCTAGCTGCTGC
CACATCAAAAACCTGTGCCACAACCGTCGCATATCCACACGAAGTTGTAAGAACAAGACTACGT
GAAGAAGGGACAAAATACAGATCTTTTTTTCAGACACTGTCTTTGATTGTTCAAGAAGAAGGCT
ATGGGTCTCTTTACCGTGGCCTAACAACTCATCTGGTGAGACAGATTCCAAACACAGCCATTAT
GATGGCCACCTACGAACTGGTGGTCTACCTACTCAACGGATAGCAGCAGGGGCTGCCGTGCTGC
AGAGCAGGAAGACCAAACGATCACAGTGGACCATGGAATATTGAAGCCAGCATGGTGGTCAGAA
GACAGTAGTGGGGAAACATGTAACTACTGTGGCTGAGTGGAAGTTTGGTTTTAGGAAGTAAGGT
ACTACCACACCACATTGATCTTTCA

hide sequence

RefSeq Acc Id:

XM_039082571 ⟹ XP_038938499

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	106,539,355 - 106,558,432 (-)	NCBI
mRatBN7.2	8	97,663,229 - 97,679,001 (-)	NCBI

RefSeq Acc Id:

XM_039082574 ⟹ XP_038938502

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	106,539,355 - 106,558,434 (-)	NCBI
mRatBN7.2	8	97,663,229 - 97,679,001 (-)	NCBI

RefSeq Acc Id:

XM_063265996 ⟹ XP_063122066

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	106,539,355 - 106,558,441 (-)	NCBI

RefSeq Acc Id:

XM_063265997 ⟹ XP_063122067

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	106,539,355 - 106,558,449 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001414658	(Get FASTA)	NCBI Sequence Viewer
	XP_008764799	(Get FASTA)	NCBI Sequence Viewer
	XP_038938499	(Get FASTA)	NCBI Sequence Viewer
	XP_038938502	(Get FASTA)	NCBI Sequence Viewer
	XP_063122066	(Get FASTA)	NCBI Sequence Viewer
	XP_063122067	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000033519
	ENSRNOP00000033519.3
	ENSRNOP00000069300.2
	ENSRNOP00000107814.1
	ENSRNOP00000109110
	ENSRNOP00000109110.1

RefSeq Acc Id:	XP_008764799 ⟸ XM_008766577
- Peptide Label:	isoform X1
- UniProtKB:	A0A0G2JV03 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSQRDTLVHLFAGGCGGTVGAILTCPLEVVKTRLQSSSVTLYISEVQLNTMAGASVNRVVSPGP LHCLKAIYFAAYSNCKEKLNGVFDPDSTQVHMISAAMAGFTAITATNPIWLIKTRLQLDARNRG EKRMGAFECVRKVYQTDGLRGFYRGMSASYAGISETVIHFVIYESIKQKLLECKTASMMETDEE SVKEASDFVRMMLAAATSKTCATTVAYPHEVVRTRLREEGTKYRSFFQTLSLIVQEEGYGSLYR GLTTHLVRQIPNTAIMMATYELVVYLLNG hide sequence

Ensembl Acc Id:

ENSRNOP00000033519 ⟸ ENSRNOT00000037120

RefSeq Acc Id:	XP_038938502 ⟸ XM_039082574
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038938499 ⟸ XM_039082571
- Peptide Label:	isoform X2

Ensembl Acc Id:

ENSRNOP00000093028 ⟸ ENSRNOT00000110158

RefSeq Acc Id:	NP_001414658 ⟸ NM_001427729
- UniProtKB:	D4ACN9 (UniProtKB/TrEMBL), A0A0G2JV03 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063122067 ⟸ XM_063265997
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063122066 ⟸ XM_063265996
- Peptide Label:	isoform X2

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4ACN9-F1-model_v2	AlphaFold	D4ACN9	1-311	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1591928	AgrOrtholog
BioCyc Gene	G2FUF-29427	BioCyc
Ensembl Genes	ENSRNOG00000013802	Ensembl
	ENSRNOG00000054284	UniProtKB/TrEMBL
	ENSRNOG00000078852	ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000037120	ENTREZGENE
	ENSRNOT00000037120.7	UniProtKB/TrEMBL
	ENSRNOT00000084366.3	UniProtKB/TrEMBL
	ENSRNOT00000131210	ENTREZGENE
	ENSRNOT00000131210.1	UniProtKB/TrEMBL
	ENSRNOT00000161335.1	UniProtKB/TrEMBL
Gene3D-CATH	1.50.40.10	UniProtKB/TrEMBL
InterPro	Mit_carrier	UniProtKB/TrEMBL
	Mitochondrial_sb/sol_carrier	UniProtKB/TrEMBL
	Mt_carrier_dom	UniProtKB/TrEMBL
	SLC25A33/36-like	UniProtKB/TrEMBL
NCBI Gene	501039	ENTREZGENE
PANTHER	MITOCHONDRIAL CARRIER PROTEIN RIM2	UniProtKB/TrEMBL
	SOLUTE CARRIER FAMILY 25 MEMBER 36	UniProtKB/TrEMBL
Pfam	Mito_carr	UniProtKB/TrEMBL
PhenoGen	Slc25a36	PhenoGen
PRINTS	MITOCARRIER	UniProtKB/TrEMBL
PROSITE	SOLCAR	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000013802	RatGTEx
	ENSRNOG00000054284	RatGTEx
	ENSRNOG00000078852	RatGTEx
Superfamily-SCOP	Mitoch_carrier	UniProtKB/TrEMBL
UniProt	A0A0G2JV03	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LSJ6_RAT	UniProtKB/TrEMBL
	A0ABK0M0G6_RAT	UniProtKB/TrEMBL
	D4ACN9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-24	Slc25a36	solute carrier family 25 member 36	Slc25a36	solute carrier family 25 (pyrimidine nucleotide carrier ), member 36	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-10-16	Slc25a36	solute carrier family 25 (pyrimidine nucleotide carrier ), member 36	Slc25a36	solute carrier family 25, member 36	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-05	Slc25a36	solute carrier family 25, member 36	LOC501039	similar to solute carrier family 25, member 36	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC501039	similar to solute carrier family 25, member 36			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM