Advanced Search (OLGA)

Gene: Il34 (interleukin 34) Rattus norvegicus

Analyze

Symbol:

Il34

Name:

interleukin 34

RGD ID:

1586038

Description:

Predicted to enable identical protein binding activity and macrophage colony-stimulating factor receptor binding activity. Predicted to be involved in several processes, including interleukin-34-mediated signaling pathway; positive regulation of cell development; and positive regulation of macromolecule metabolic process. Predicted to act upstream of or within positive regulation of MAPK cascade. Predicted to be located in extracellular region. Predicted to be active in extracellular space. Orthologous to human IL34 (interleukin 34); INTERACTS WITH 2,3,7,8-Tetrachlorodibenzofuran; 3,3',4,4',5-pentachlorobiphenyl; 4,4'-sulfonyldiphenol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

IL-34; interleukin-34; LOC498951; MGC112852; similar to 2010004A03Rik protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	IL34 (interleukin 34)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Il34 (interleukin 34)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Il34 (interleukin 34)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	IL34 (interleukin 34)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	IL34 (interleukin 34)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Il34 (interleukin 34)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	IL34 (interleukin 34)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	IL34 (interleukin 34)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Il34 (interleukin 34)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Il34 (interleukin 34)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Il34 (interleukin 34)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	IL34 (interleukin 34)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	il34 (interleukin 34)	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	il34	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	55,624,368 - 55,690,576 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	55,624,369 - 55,673,376 (-)	Ensembl				GRCr8
mRatBN7.2	19	38,714,990 - 38,782,749 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	38,714,991 - 38,764,000 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	45,520,176 - 45,534,560 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	46,173,544 - 46,187,927 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	48,484,111 - 48,498,359 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	40,855,537 - 40,905,007 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	40,855,433 - 40,904,121 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	51,680,005 - 51,729,266 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	40,662,723 - 40,676,634 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	38,108,703 - 38,123,111 (-)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

polycystic ovary syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

17beta-estradiol (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2-hydroxypropanoic acid (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP,ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

all-trans-retinoic acid (ISO)

amitrole (EXP)

atrazine (EXP)

benzalkonium chloride (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

Butylbenzyl phthalate (ISO)

calcitriol (ISO)

clotrimazole (EXP)

copper(II) sulfate (ISO)

diethylstilbestrol (EXP)

epoxiconazole (ISO)

fonofos (ISO)

genistein (ISO)

lead(0) (ISO)

methimazole (EXP)

microcystin-LR (ISO)

mono(2-ethylhexyl) phthalate (ISO)

nickel atom (ISO)

ozone (ISO)

paracetamol (ISO)

paraquat (EXP)

parathion (ISO)

pirinixic acid (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

silver atom (ISO)

silver(0) (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

terbufos (ISO)

tetrachloromethane (ISO)

trichloroethene (EXP)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

immune system process (IEA)

inflammatory response (IEA)

innate immune response (IEA)

interleukin-34-mediated signaling pathway (ISO)

microglial cell proliferation (ISO)

positive regulation of cell development (IEA)

positive regulation of cell population proliferation (IBA,IEA,ISO,ISS)

positive regulation of gene expression (ISO)

positive regulation of macromolecule metabolic process (IEA)

positive regulation of macrophage chemotaxis (ISO)

positive regulation of macrophage differentiation (IBA,ISO)

positive regulation of macrophage proliferation (ISO)

positive regulation of MAPK cascade (ISO)

positive regulation of monocyte differentiation (IBA,ISO)

positive regulation of multicellular organismal process (IEA)

positive regulation of oligodendrocyte differentiation (ISO,ISS)

positive regulation of protein phosphorylation (ISO,ISS)

regulation of multicellular organismal development (IEA)

signal transduction (IEA)

Cellular Component

extracellular region (IEA)

extracellular space (IBA,IEA,ISO,ISS)

Molecular Function

cytokine activity (IEA)

growth factor activity (IEA)

identical protein binding (ISO)

macrophage colony-stimulating factor receptor binding (IBA,IEA,ISO,ISS)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Discovery of a cytokine and its receptor by functional screening of the extracellular proteome.	Lin H, etal., Science. 2008 May 9;320(5877):807-11. doi: 10.1126/science.1154370.
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15489334	PMID:22483114	PMID:23392676	PMID:23409120	PMID:26389674	PMID:26754294	PMID:27445335	PMID:30687013	PMID:36030499

Genomics

Comparative Map Data

Il34
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	55,624,368 - 55,690,576 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	55,624,369 - 55,673,376 (-)	Ensembl				GRCr8
mRatBN7.2	19	38,714,990 - 38,782,749 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	38,714,991 - 38,764,000 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	45,520,176 - 45,534,560 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	46,173,544 - 46,187,927 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	48,484,111 - 48,498,359 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	40,855,537 - 40,905,007 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	40,855,433 - 40,904,121 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	51,680,005 - 51,729,266 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	40,662,723 - 40,676,634 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	38,108,703 - 38,123,111 (-)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

IL34
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	70,579,899 - 70,660,682 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	70,579,878 - 70,661,556 (+)	Ensembl			hg38	GRCh38
GRCh37	16	70,613,802 - 70,694,585 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	69,237,969 - 69,252,085 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	16	54,830,211 - 54,914,394 (-)	NCBI		Celera
Cytogenetic Map	16	q22.1	NCBI
HuRef	16	56,444,788 - 56,526,038 (+)	NCBI		HuRef
CHM1_1	16	72,021,130 - 72,101,930 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	76,391,088 - 76,471,868 (+)	NCBI		T2T-CHM13v2.0

Il34
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	111,467,809 - 111,532,579 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	111,468,461 - 111,532,556 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	8	110,741,829 - 110,805,949 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	110,741,829 - 110,805,924 (-)	Ensembl			mm10	GRCm38
MGSCv37	8	113,265,729 - 113,329,803 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	8	113,628,517 - 113,692,549 (-)	NCBI		MGSCv36	mm8
Celera	8	114,965,768 - 115,029,412 (-)	NCBI		Celera
Cytogenetic Map	8	E1	NCBI
cM Map	8	57.68	NCBI

Il34
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955484	3,416,965 - 3,428,574 (+)	Ensembl
ChiLan1.0	NW_004955484	3,362,240 - 3,429,031 (+)	NCBI	ChiLan1.0	ChiLan1.0

IL34
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	83,505,787 - 83,583,507 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	89,439,379 - 89,512,788 (-)	NCBI		NHGRI_mPanPan1
PanPan1.1 Ensembl	16	70,480,917 - 70,494,693 (+)	Ensembl			panPan2	panpan1.1

IL34
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	76,601,310 - 76,612,665 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	76,555,214 - 76,625,012 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	76,562,564 - 76,573,722 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	77,037,777 - 77,049,154 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	76,991,631 - 77,049,148 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	76,859,645 - 76,871,004 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	76,682,464 - 76,693,813 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	77,174,314 - 77,185,475 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Il34
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	36,558,176 - 36,621,152 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936475	22,967,930 - 22,979,641 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936475	22,967,962 - 22,979,954 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

IL34
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	13,588,787 - 13,659,895 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	13,588,748 - 13,679,864 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	13,511,317 - 13,512,804 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

IL34
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	53,731,330 - 53,802,142 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	53,731,379 - 53,801,650 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666047	16,529,863 - 16,614,250 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Il34
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	12,861,018 - 12,867,587 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624746	12,793,797 - 12,867,591 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Il34
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	17	30,450,781 - 30,512,906 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Il34
283 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	399
Count of miRNA genes:	224
Interacting mature miRNAs:	263
Transcripts:	ENSRNOT00000023823
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	19220689	64220689	Rat
724546	Kidm3	Kidney mass QTL 3	3.1		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	19	46226778	74246245	Rat
631840	Niddm38	Non-insulin dependent diabetes mellitus QTL 38	3.86		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	19	10329076	74246245	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	32365311	74246245	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	24093973	69093973	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	36289	74246245	Rat
2303628	Vencon9	Ventilatory control QTL 9		0.005	respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	19	23188586	68188586	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10833618	74246245	Rat
2313395	Anxrr26	Anxiety related response QTL 26			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	19	44385134	74246245	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	32539615	74246245	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	31777888	74246245	Rat
1554318	Bmd5	Bone mineral density QTL 5	12.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	19	23188586	68188586	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	20109306	65109306	Rat
1549835	Tcas7	Tongue tumor susceptibility QTL 7		0.001	tongue integrity trait (VT:0010553)	squamous cell carcinoma of the head and neck tumor number (CMO:0001876)	19	41722546	74246245	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2194317	74246245	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2194317	74246245	Rat

Markers in Region

RH127794

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	38,715,040 - 38,715,221 (-)	MAPPER	mRatBN7.2
Rnor_6.0	19	40,904,133 - 40,904,313	NCBI	Rnor6.0
Rnor_5.0	19	51,728,392 - 51,728,572	UniSTS	Rnor5.0
RGSC_v3.4	19	40,662,774 - 40,662,954	UniSTS	RGSC3.4
Celera	19	38,108,754 - 38,108,934	UniSTS
RH 3.4 Map	19	470.1	UniSTS
Cytogenetic Map	19	q12	UniSTS

BE120045

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	38,717,096 - 38,717,253 (-)	MAPPER	mRatBN7.2
Rnor_6.0	19	40,902,101 - 40,902,257	NCBI	Rnor6.0
Rnor_5.0	19	51,726,360 - 51,726,516	UniSTS	Rnor5.0
RGSC_v3.4	19	40,664,830 - 40,664,986	UniSTS	RGSC3.4
Celera	19	38,110,810 - 38,110,966	UniSTS
RH 3.4 Map	19	471.2	UniSTS
Cytogenetic Map	19	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	59	157	91	90	59	89	59	6	345	181	11	136	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025766	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001434595	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001434596	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006255599	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006255600	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097930	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097931	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097932	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097933	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063278199	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC076391	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC098808	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MW395510	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000023823 ⟹ ENSRNOP00000023823

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	55,624,369 - 55,673,376 (-)	Ensembl
mRatBN7.2 Ensembl	19	38,714,991 - 38,764,000 (-)	Ensembl
Rnor_6.0 Ensembl	19	40,855,433 - 40,904,121 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000140699 ⟹ ENSRNOP00000108432

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	55,624,369 - 55,638,198 (-)	Ensembl

RefSeq Acc Id:

NM_001025766 ⟹ NP_001020937

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	55,624,368 - 55,638,605 (-)	NCBI
mRatBN7.2	19	38,714,990 - 38,729,226 (-)	NCBI
Rnor_6.0	19	40,890,544 - 40,904,364 (+)	NCBI
Rnor_5.0	19	51,680,005 - 51,729,266 (+)	NCBI
RGSC_v3.4	19	40,662,723 - 40,676,634 (-)	RGD
Celera	19	38,108,703 - 38,123,111 (-)	RGD

Sequence:

show sequence

CTGCAGTCGGGAGAAACCAGAGAAAGCGCCACCCAGCCCCAGATTCCAAGAGGCCTGCTGGGGA
CTCCCTTCTCTTCCTCCTCCTTCTCCTCTCCCTCTTCCTCCTCCTCCTGAGACCCCAAAGCCAC
TGTCTCACACCACTTCCTGAGCCGCAATGGAGCTCCCAGCCACCGCCCCCTGGCTGTCCTCTAC
CCTGACAAGCAGATAGGGCGGCCGGTAGCTACCCCAGGAGTACCTGCCCCCTCTCAGCCTGGGG
CAGCCCTTCCTGGACTTGGTGGCCACCTTTGCTGACCTGAGGCCATGTAGGCCCTGGCTCAGGC
TTCCGGATACACTGCTGGGGACAGTGCCTCTGCTCTCAGGGGGCACCCAGTGCACCATCATGCC
CTGGGGACTCGCCTGGTTATACTGTCTTGGGATCCTACTTGACGTGGCTTTGGGAAACGAGAAT
TTGGAGATATGGACTCTGGCCCAAGATAAAGAATGTGATCTTACAGGCTACCTTCGGGGCAAGC
TGCAGTACAAGAACCGGCTTCAGTACATGAAACATTACTTCCCCATCAACTACAGGATTGCTGT
GCCTTATGAGGGGGTACTCAGAGTGGCCAACATCACGAGGCTGAAGGCCCATGTGAGTGAGCGA
GAGCTGCGGTACCTGTGGGTCTTGGTGAGCCTCAACGCCACTGAGTCTGTGCTGGATGTGCTGC
TGGAGGGACACCCATCCTGGAAGTATCTACAGGAGGTTCAGACATTGCTGGAGAATGTTCAGCG
GAGCCTCATGGATGTGGAGATTGGCCCTCACGTGGAAGCTGTGTTATCTCTTCTGAGTACCCCT
GGCCTAAGCCTGAAGCTGGTGCGGCCCAAAGCCTTGTTGGATAACTGCTTCCGGGTCATGGAGC
TGCTGTACTGCTCTTGCTGCAAACAAAGTCCCATCTTAAAATGGCAGGACTGTGAGCTGCCCAG
GCTCCATCCCCACAGTCCAGAGTCCTTGATGCAATGTGCAGCTACCAACGTGTACCCTTTGCCT
CGGCAGCCCCCCACCTCCCTGCCCAGGTCCCCAAGTTCAAACCATGGCCCGTTGCCCTGAGCAA
TCTGTGTGTTGACCCTGTGTCGGGCCACTGGATGTGTTTCAGAAACCAGCCTGGGTCTGAGACT
TTCCTGGATATTGGGTAGGTAGCCCTTTAGGAAAGGCCTCCTGCCTTCTCTTCCACACCCAGGC
TTCCTGCCTTCTGTACCTGTGATATCACCTGGAGCCTCGGGGAGGGTTGTGGAGGGGATGGCTG
GTTGTTATCCCCTACAGCCACCTCTACCTGTAGCCGGTTCTAAAATCTGCGAACACTGTTGCCC
CACAGGTGGGTGGCCAATAACTACTGGGTGCCACATAGGATTCCGGGACTTCCTGGGGCTTTTC
AGTTGTGTTGATTGTGGGGTGCTGGACCAAGGACGGACCAATTGCCATATCTTGCCACGACAAT
GTTCTTCTGGCTCCTTTTTCTATTAAATGGCCATTTGTTTGGTTTGGCTTGCAAAAAAAAAAAA
AAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039097930 ⟹ XP_038953858

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	55,624,368 - 55,688,428 (-)	NCBI
mRatBN7.2	19	38,714,990 - 38,779,042 (-)	NCBI

RefSeq Acc Id:

XM_039097931 ⟹ XP_038953859

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	55,624,368 - 55,641,484 (-)	NCBI
mRatBN7.2	19	38,714,990 - 38,732,293 (-)	NCBI

RefSeq Acc Id:

XM_039097932 ⟹ XP_038953860

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	55,624,368 - 55,688,426 (-)	NCBI
mRatBN7.2	19	38,714,990 - 38,779,053 (-)	NCBI

RefSeq Acc Id:

XM_039097933 ⟹ XP_038953861

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	55,624,809 - 55,690,576 (-)	NCBI
mRatBN7.2	19	38,715,460 - 38,782,749 (-)	NCBI

RefSeq Acc Id:

XM_063278199 ⟹ XP_063134269

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	55,624,368 - 55,688,114 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001020937	(Get FASTA)	NCBI Sequence Viewer
	NP_001421524	(Get FASTA)	NCBI Sequence Viewer
	NP_001421525	(Get FASTA)	NCBI Sequence Viewer
	XP_038953858	(Get FASTA)	NCBI Sequence Viewer
	XP_038953859	(Get FASTA)	NCBI Sequence Viewer
	XP_038953860	(Get FASTA)	NCBI Sequence Viewer
	XP_038953861	(Get FASTA)	NCBI Sequence Viewer
	XP_063134269	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH98808	(Get FASTA)	NCBI Sequence Viewer
	EDL92546	(Get FASTA)	NCBI Sequence Viewer
	EDL92547	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000023823
GenBank Protein	Q4KM46	(Get FASTA)	NCBI Sequence Viewer
	QST77543	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001020937 ⟸ NM_001025766
- Peptide Label:	precursor
- UniProtKB:	Q4KM46 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MPWGLAWLYCLGILLDVALGNENLEIWTLAQDKECDLTGYLRGKLQYKNRLQYMKHYFPINYRI AVPYEGVLRVANITRLKAHVSERELRYLWVLVSLNATESVLDVLLEGHPSWKYLQEVQTLLENV QRSLMDVEIGPHVEAVLSLLSTPGLSLKLVRPKALLDNCFRVMELLYCSCCKQSPILKWQDCEL PRLHPHSPESLMQCAATNVYPLPRQPPTSLPRSPSSNHGPLP hide sequence

Ensembl Acc Id:

ENSRNOP00000023823 ⟸ ENSRNOT00000023823

RefSeq Acc Id:	XP_038953860 ⟸ XM_039097932
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038953858 ⟸ XM_039097930
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038953859 ⟸ XM_039097931
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038953861 ⟸ XM_039097933
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063134269 ⟸ XM_063278199
- Peptide Label:	isoform X1
- UniProtKB:	A0A140TAD0 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000108432 ⟸ ENSRNOT00000140699

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4KM46-F1-model_v2	AlphaFold	Q4KM46	1-234	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1586038	AgrOrtholog
BioCyc Gene	G2FUF-5686	BioCyc
Ensembl Genes	ENSRNOG00000017602	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000023823	ENTREZGENE
Gene3D-CATH	1.20.1250.80	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7106821	IMAGE-MGC_LOAD
	IMAGE:7376793	IMAGE-MGC_LOAD
InterPro	IL-34	UniProtKB/Swiss-Prot
	IL-34_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:498951	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:112852	IMAGE-MGC_LOAD
	MGC:94787	IMAGE-MGC_LOAD
NCBI Gene	498951	ENTREZGENE
PANTHER	INTERLEUKIN-34	UniProtKB/Swiss-Prot
	PTHR28606	UniProtKB/Swiss-Prot
Pfam	IL34	UniProtKB/Swiss-Prot
PhenoGen	Il34	PhenoGen
PRINTS	INTRLEUKIN34	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000017602	RatGTEx
UniProt	A0A140TAD0	ENTREZGENE, UniProtKB/TrEMBL
	A0A8A1UCG2_RAT	UniProtKB/TrEMBL
	A0ABK0LQW4_RAT	UniProtKB/TrEMBL
	IL34_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-10-23	Il34	interleukin 34	LOC498951	similar to 2010004A03Rik protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-19	LOC498951	similar to 2010004A03Rik protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD