Advanced Search (OLGA)

Gene: Tuba8 (tubulin, alpha 8) Rattus norvegicus

Analyze

Symbol:

Tuba8

Name:

tubulin, alpha 8

RGD ID:

1566041

Description:

Predicted to enable GTP binding activity. Predicted to be a structural constituent of cytoskeleton. Predicted to be involved in microtubule cytoskeleton organization; mitotic cell cycle; and spermatid development. Predicted to be located in cytoskeleton and membrane raft. Predicted to be active in acrosomal vesicle and microtubule. Human ortholog(s) of this gene implicated in autosomal dominant isolated macrothrombocytopenia 2. Orthologous to human TUBA8 (tubulin alpha 8); PARTICIPATES IN phagocytosis pathway; INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

alpha-tubulin 8; LOC500377; similar to Tubulin alpha-8 chain (Alpha-tubulin 8); tubulin alpha-8 chain

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TUBA8 (tubulin alpha 8)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, Panther, PhylomeDB
Mus musculus (house mouse):	Tuba8 (tubulin, alpha 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tuba8 (tubulin alpha 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TUBA8 (tubulin alpha 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TUBA8 (tubulin alpha 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tuba8 (tubulin alpha 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TUBA8 (tubulin alpha 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TUBA8 (tubulin alpha 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tuba8 (tubulin alpha 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Tuba8 (tubulin alpha 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	IRX3 (iroquois homeobox 3)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	TUBA8 (tubulin alpha 8)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Tuba8 (tubulin, alpha 8)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tuba4l (tubulin, alpha 4 like)	Alliance	DIOPT (OrthoFinder\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	TUB1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	TUB1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	TUB3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	alphaTub84B	Alliance	DIOPT (PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	alphaTub84D	Alliance	DIOPT (PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	tba-9	Alliance	DIOPT (OMA\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	tba-1	Alliance	DIOPT (Ensembl Compara\|OMA)
Caenorhabditis elegans (roundworm):	tba-2	Alliance	DIOPT (Ensembl Compara\|OMA)
Caenorhabditis elegans (roundworm):	tba-2	Alliance	DIOPT (Ensembl Compara\|OMA\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	tuba8	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	tuba8	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	156,110,562 - 156,129,065 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	156,111,964 - 156,141,436 (+)	Ensembl				GRCr8
mRatBN7.2	4	154,440,045 - 154,456,918 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	154,440,074 - 154,456,917 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	160,705,807 - 160,723,049 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	156,489,290 - 156,506,534 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	155,112,778 - 155,130,023 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	153,774,511 - 153,791,223 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	153,774,486 - 153,791,328 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	220,863,728 - 220,880,838 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	4	143,280,073 - 143,296,818 (+)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

atrial fibrillation (ISO)

autosomal dominant isolated macrothrombocytopenia 2 (ISO)

Duane retraction syndrome (ISO)

microcephaly (ISO)

Polymicrogyria with Optic Nerve Hypoplasia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4,4'-trichlorobiphenyl (ISO)

2,4,6-tribromophenol (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP,ISO)

acrylamide (EXP)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzo[a]pyrene (EXP,ISO)

Benzo[k]fluoranthene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

cadmium dichloride (EXP)

cantharidin (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

choline (ISO)

cobalt dichloride (ISO)

cocaine (ISO)

Cuprizon (EXP)

decabromodiphenyl ether (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dibenzofurans (ISO)

diiodine (ISO)

doxorubicin (ISO)

ethanol (ISO)

folic acid (ISO)

gentamycin (EXP)

graphite (EXP)

indometacin (ISO)

isoprenaline (ISO)

L-methionine (ISO)

lead nitrate (EXP)

lipopolysaccharide (ISO)

mercury atom (ISO)

mercury(0) (ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

PCB138 (ISO)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenobarbital (ISO)

pirinixic acid (ISO)

propiconazole (ISO)

quercetin (EXP)

rotenone (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

S-nitrosoglutathione (ISO)

sodium fluoride (ISO)

sunitinib (ISO)

tamoxifen (ISO)

testosterone (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (EXP,ISO)

trichloroethene (EXP)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cytoskeleton organization (IEA)

microtubule cytoskeleton organization (IBA)

microtubule-based process (IEA)

mitotic cell cycle (IBA)

spermatid development (ISO)

spermatogenesis (ISO)

Cellular Component

acrosomal vesicle (ISO)

cytoplasm (IBA,ISO)

cytoskeleton (IEA)

membrane raft (IEA)

microtubule (IBA,IEA)

microtubule cytoskeleton (IEA,ISO)

Molecular Function

GTP binding (IBA,IEA)

hydrolase activity (IEA)

metal ion binding (IEA)

nucleotide binding (IEA)

protein binding (ISO)

structural constituent of cytoskeleton (IBA,IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

phagocytosis pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	A revised nomenclature for the human and rodent alpha-tubulin gene family.	Khodiyar VK, etal., Genomics. 2007 May 31;.
3.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334	PMID:29476059

Genomics

Comparative Map Data

Tuba8
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	156,110,562 - 156,129,065 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	156,111,964 - 156,141,436 (+)	Ensembl				GRCr8
mRatBN7.2	4	154,440,045 - 154,456,918 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	154,440,074 - 154,456,917 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	160,705,807 - 160,723,049 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	156,489,290 - 156,506,534 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	155,112,778 - 155,130,023 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	153,774,511 - 153,791,223 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	153,774,486 - 153,791,328 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	220,863,728 - 220,880,838 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	4	143,280,073 - 143,296,818 (+)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

TUBA8
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	18,110,809 - 18,131,732 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	18,110,100 - 18,146,683 (+)	Ensembl			hg38	GRCh38
GRCh37	22	18,593,575 - 18,614,499 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	16,973,559 - 16,994,498 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	22	16,968,112 - 16,989,052	NCBI
Celera	22	2,212,521 - 2,233,563 (+)	NCBI		Celera
Cytogenetic Map	22	q11.21	NCBI
HuRef	22	2,405,998 - 2,426,924 (+)	NCBI		HuRef
CHM1_1	22	18,593,173 - 18,614,215 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	22	18,782,719 - 18,803,642 (+)	NCBI		T2T-CHM13v2.0

Tuba8
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	121,187,666 - 121,209,304 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	121,187,655 - 121,203,813 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	121,210,734 - 121,226,098 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	121,210,696 - 121,226,854 (+)	Ensembl			mm10	GRCm38
MGSCv37	6	121,160,788 - 121,176,115 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	121,176,389 - 121,191,716 (+)	NCBI		MGSCv36	mm8
Celera	6	123,044,550 - 123,060,095 (+)	NCBI		Celera
Cytogenetic Map	6	F1	NCBI
cM Map	6	57.15	NCBI

Tuba8
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955454	6,129,612 - 6,148,645 (+)	Ensembl
ChiLan1.0	NW_004955454	6,129,821 - 6,148,645 (+)	NCBI	ChiLan1.0	ChiLan1.0

TUBA8
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	23	28,427,414 - 28,461,175 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	22	30,975,349 - 31,009,108 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	22	1,541,154 - 1,561,852 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	22	16,969,150 - 17,012,868 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	22	16,936,405 - 16,989,730 (+)	Ensembl			panPan2	panpan1.1

TUBA8
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	45,706,576 - 45,725,679 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	27	45,675,472 - 45,725,681 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	958,092 - 977,176 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	46,073,905 - 46,093,210 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	27	46,045,486 - 46,094,019 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	27	46,001,476 - 46,020,589 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	45,975,073 - 45,993,987 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	313,717 - 332,829 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Tuba8
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	109,855,015 - 109,884,560 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936807	1,061,529 - 1,084,228 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936807	1,061,542 - 1,079,438 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TUBA8
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	70,153,922 - 70,179,970 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	5	70,154,251 - 70,174,001 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	72,507,682 - 72,527,225 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TUBA8
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1 Ensembl	19	2,285,937 - 2,330,734 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM

Tuba8
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624735	9,211,152 - 9,230,303 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624735	9,211,458 - 9,229,909 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Tuba8
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	25,513,840 - 25,530,501 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Tuba8
146 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	26
Count of miRNA genes:	26
Interacting mature miRNAs:	26
Transcripts:	ENSRNOT00000074096
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
6478754	Anxrr43	Anxiety related response QTL 43		0.14035	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	146370897	184426481	Rat
724558	Plsm2	Polydactyly-luxate syndrome (PLS) morphotypes QTL 2		0.0003	hindlimb integrity trait (VT:0010563)	hind foot phalanges count (CMO:0001949)	4	134095016	179095016	Rat
1582237	Kidm34	Kidney mass QTL 34	4	0.0001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	4	149763204	169799698	Rat
61446	Coreg2	Compensatory renal growth QTL 2	3.5		kidney mass (VT:0002707)	compensatory renal growth score (CMO:0001894)	4	150095743	159267220	Rat
6478693	Anxrr32	Anxiety related response QTL 32		0.00092	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	146370897	184426481	Rat
6478757	Anxrr44	Anxiety related response QTL 44		0.01087	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
1358364	Sradr4	Stress Responsive Adrenal Weight QTL 4	4.92		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	131384565	176384565	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	27730518	170099664	Rat
6478763	Anxrr46	Anxiety related response QTL 46		0.07428	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	112427331	157427331	Rat
6478760	Anxrr45	Anxiety related response QTL 45		0.06717	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	112427331	157427331	Rat
61451	Ciaa4	CIA Autoantibody QTL 4	3.1		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	4	123870974	168870974	Rat
1331802	Srn5	Serum renin concentration QTL 5	3.045		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	4	117559384	162559384	Rat
1331738	Bp209	Blood pressure QTL 209	2.979		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	140059299	181024663	Rat
6478700	Anxrr33	Anxiety related response QTL 33		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
1298524	Oia8	Oil induced arthritis QTL 8			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	140059299	184426481	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	60916264	184426481	Rat
7207480	Bss105	Bone structure and strength QTL 105	8.1		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	4	111383604	156383604	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	94638356	168870820	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	106848959	168870974	Rat
7411558	Bw133	Body weight QTL 133	13.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	127263297	172263297	Rat
6478778	Anxrr51	Anxiety related response QTL 51		0.25384	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	126334185	171334185	Rat
10401796	Kidm48	Kidney mass QTL 48			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	147299608	184426481	Rat
6478718	Anxrr34	Anxiety related response QTL 34		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
6478782	Anxrr52	Anxiety related response QTL 52		0.02091	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
631511	Pia7	Pristane induced arthritis QTL 7	4.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	123870974	168870974	Rat
1549832	Bss3	Bone structure and strength QTL 3	11		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	4	111383604	156383604	Rat
634347	Hcar8	Hepatocarcinoma resistance QTL 8	5.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	124700988	169700988	Rat
6478720	Alc23	Alcohol consumption QTL 23		0.00509	drinking behavior trait (VT:0001422)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	155834926	184426481	Rat
6478785	Anxrr53	Anxiety related response QTL 53		0.01397	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	174095838	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	100752691	179366077	Rat
1581566	Eae21	Experimental allergic encephalomyelitis QTL 21	6.2		body mass (VT:0001259)	maximum body weight loss to initial body weight ratio (CMO:0001400)	4	137447185	182447185	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	45429709	157555683	Rat
1578674	Bmd12	Bone mineral density QTL 12	3.8		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	4	137430611	182430611	Rat
6478728	Anxrr36	Anxiety related response QTL 36		0.01061	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	184426481	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	86709649	168870974	Rat
61422	Cia13	Collagen induced arthritis QTL 13	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	134199006	168870974	Rat
634342	Cia24	Collagen induced arthritis QTL 24	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	148121375	176967367	Rat
6478733	Anxrr37	Anxiety related response QTL 37		0.00095	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
737978	Pia23	Pristane induced arthritis QTL 23	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	123870974	168870974	Rat
61362	Oia2	Oil induced arthritis QTL 2		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	140059299	184426481	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	65495851	159259805	Rat
6478737	Anxrr38	Anxiety related response QTL 38		0.00159	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
12798519	Anxrr54	Anxiety related response QTL 54	2.54	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	116184844	161184844	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat
6478748	Anxrr42	Anxiety related response QTL 42		0.28008	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
12798525	Anxrr57	Anxiety related response QTL 57	3.21	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	148834094	168870974	Rat

Markers in Region

RH144572

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	154,452,488 - 154,452,695 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	153,786,794 - 153,787,000	NCBI	Rnor6.0
Rnor_5.0	4	220,876,409 - 220,876,615	UniSTS	Rnor5.0
Celera	4	143,292,416 - 143,292,622	UniSTS
RH 3.4 Map	4	995.9	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
13	12	65	148	83	82	51	82	51	6	330	180	11	123	78	88	31	15	15

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001024339	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592844	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039108236	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC079185	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473964	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217798	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000074096 ⟹ ENSRNOP00000065108

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	156,112,078 - 156,141,436 (+)	Ensembl
mRatBN7.2 Ensembl	4	154,440,074 - 154,456,917 (+)	Ensembl
Rnor_6.0 Ensembl	4	153,774,486 - 153,791,328 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094482 ⟹ ENSRNOP00000079773

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	156,118,898 - 156,129,060 (+)	Ensembl
mRatBN7.2 Ensembl	4	154,446,523 - 154,456,917 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000102041 ⟹ ENSRNOP00000086703

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	156,111,964 - 156,129,060 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000131696 ⟹ ENSRNOP00000110999

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	156,112,078 - 156,130,273 (+)	Ensembl

RefSeq Acc Id:

NM_001024339 ⟹ NP_001019510

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	156,112,272 - 156,129,061 (+)	NCBI
mRatBN7.2	4	154,440,130 - 154,456,918 (+)	NCBI
Rnor_6.0	4	153,774,511 - 153,791,223 (+)	NCBI
Rnor_5.0	4	220,863,728 - 220,880,838 (+)	NCBI
Celera	4	143,280,073 - 143,296,818 (+)	RGD

Sequence:

show sequence

CAACCGCGGAGGCGGCCGTATCTGGAGCAGTTGGGGTGGGCAGGCCCAGCTGGGAGGCGAGCGG
GCGAAGAGAGCGGCCACGATGAGGGAATGCATATCAGTCCATGTGGGTCAAGCGGGAGTTCAGA
TTGGCAATGCCTGCTGGGAGCTCTTCTGTTTGGAGCATGGTATCCAGGCGGATGGGACCTTTGG
CACTCAGGCCAGCAAGATCAACGACGACGACTCCTTCACCACATTTTTCAGTGAGACTGGCAAC
GGAAAACATGTGCCCCGGGCTGTCATGGTGGACCTGGAGCCTACAGTAGTAGACGAGGTGCGGG
CAGGGACCTACCGCCAGCTCTTCCACCCTGAGCAGCTGATCACAGGGAAGGAGGATGCAGCTAA
CAATTACGCCCGCGGACACTATACGGTGGGCAAGGAGAGCATCGATCTGGTGCTGGACCGGATC
CGTAAACTGACTGATGCCTGCTCCGGCTTGCAGGGTTTCCTGATCTTCCACAGTTTTGGTGGGG
GCACAGGCTCTGGCTTCACTTCTCTGCTGATGGAACGCCTTTCTCTTGATTATGGCAAGAAGTC
CAAGCTAGAATTTGCCATCTACCCAGCCCCACAGGTCTCCACAGCAGTGGTGGAGCCCTATAAC
TCCATCCTGACCACCCATACCACTCTGGAACACTCTGATTGTGCTTTCATGGTGGACAATGAAG
CCATCTACGACATCTGCCGCAGGAACCTGGATATTGAGCGCCCCACCTATACCAACCTCAACCG
CCTCATCAGCCAGATTGTCTCCTCCATCACGGCCTCTCTCCGCTTTGATGGAGCCCTCAACGTG
GACCTCACAGAGTTCCAGACCAACCTGGTACCCTACCCCCGAATCCACTTCCCGCTGGTCACTT
ACGCACCCATCGTCTCTGCCGAGAAAGCCTACCACGAGCAGCTGTCTGTGGCAGAGATAACCAG
CTCTTGCTTCGAGCCCAACAGCCAGATGGTGAAATGTGACCCACGTCACGGCAAATACATGGCC
TGCTGCATGCTCTACCGTGGTGATGTGGTACCCAAGGATGTGAATGTCGCCATTGCTGCCATCA
AGACCAAGAGAACTATTCAGTTTGTTGACTGGTGTCCCACAGGCTTCAAGGTGGGCATTAACTA
CCAGCCACCTACTGTCGTGCCAGGAGGAGACCTGGCCAAAGTCCAGCGAGCAGTATGCATGCTG
AGCAACACCACAGCAATCGCAGAGGCCTGGGCCCGCCTTGACCATAAGTTCGACCTCATGTATG
CCAAACGGGCCTTTGTACATTGGTATGTTGGAGAGGGAATGGAAGAAGGAGAATTTTCTGAGGC
CAGGGAGGACCTGGCTGCTCTGGAGAAGGATTATGAAGAAGTGGGGACTGATTCGTTTGAAGAA
GAAAATGAGGGGGAGGAATTTTAAATATACACTTGCCCCATGAAAAAAAAAAAAAAAAAAAAAA
AAAAAA

hide sequence

RefSeq Acc Id:

XM_017592844 ⟹ XP_017448333

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	156,110,562 - 156,129,065 (+)	NCBI
mRatBN7.2	4	154,440,045 - 154,456,918 (+)	NCBI
Rnor_6.0	4	153,774,627 - 153,791,223 (+)	NCBI

Sequence:

show sequence

CGCGCGCAGGTGCCGGGGCAGAGAGCTGCGGGGCCACCGGGTAGCTGTGGAGTGGTTTTGGATC
TACTGGGCTCCAAGTCTCCTGGAGGGGCTGTGGAGGGAATGCATATCAGTCCATGTGGGTCAAG
CGGGAGTTCAGATTGGCAATGCCTGCTGGGAGCTCTTCTGTTTGGAGCATGGTATCCAGGCGGA
TGGGACCTTTGGCACTCAGGCCAGCAAGATCAACGACGACGACTCCTTCACCACATTTTTCAGT
GAGACTGGCAACGGAAAACATGTGCCCCGGGCTGTCATGGTGGACCTGGAGCCTACAGTAGTAG
ACGAGGTGCGGGCAGGGACCTACCGCCAGCTCTTCCACCCTGAGCAGCTGATCACAGGGAAGGA
GGATGCAGCTAACAATTACGCCCGCGGACACTATACGGTGGGCAAGGAGAGCATCGATCTGGTG
CTGGACCGGATCCGTAAACTGACTGATGCCTGCTCCGGCTTGCAGGGTTTCCTGATCTTCCACA
GTTTTGGTGGGGGCACAGGCTCTGGCTTCACTTCTCTGCTGATGGAACGCCTTTCTCTTGATTA
TGGCAAGAAGTCCAAGCTAGAATTTGCCATCTACCCAGCCCCACAGGTCTCCACAGCAGTGGTG
GAGCCCTATAACTCCATCCTGACCACCCATACCACTCTGGAACACTCTGATTGTGCTTTCATGG
TGGACAATGAAGCCATCTACGACATCTGCCGCAGGAACCTGGATATTGAGCGCCCCACCTATAC
CAACCTCAACCGCCTCATCAGCCAGATTGTCTCCTCCATCACGGCCTCTCTCCGCTTTGATGGA
GCCCTCAACGTGGACCTCACAGAGTTCCAGACCAACCTGGTACCCTACCCCCGAATCCACTTCC
CGCTGGTCACTTACGCACCCATCGTCTCTGCCGAGAAAGCCTACCACGAGCAGCTGTCTGTGGC
AGAGATAACCAGCTCTTGCTTCGAGCCCAACAGCCAGATGGTGAAATGTGACCCACGTCACGGC
AAATACATGGCCTGCTGCATGCTCTACCGTGGTGATGTGGTACCCAAGGATGTGAATGTCGCCA
TTGCTGCCATCAAGACCAAGAGAACTATTCAGTTTGTTGACTGGTGTCCCACAGGCTTCAAGGT
GGGCATTAACTACCAGCCACCTACTGTCGTGCCAGGAGGAGACCTGGCCAAAGTCCAGCGAGCA
GTATGCATGCTGAGCAACACCACAGCAATCGCAGAGGCCTGGGCCCGCCTTGACCATAAGTTCG
ACCTCATGTATGCCAAACGGGCCTTTGTACATTGGTATGTTGGAGAGGGAATGGAAGAAGGAGA
ATTTTCTGAGGCCAGGGAGGACCTGGCTGCTCTGGAGAAGGATTATGAAGAAGTGGGGACTGAT
TCGTTTGAAGAAGAAAATGAGGGGGAGGAATTTTAAATATACACTTGCCCCATGA

hide sequence

RefSeq Acc Id:

XM_039108236 ⟹ XP_038964164

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	156,118,120 - 156,129,065 (+)	NCBI
mRatBN7.2	4	154,446,940 - 154,456,918 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001019510	(Get FASTA)	NCBI Sequence Viewer
	XP_017448333	(Get FASTA)	NCBI Sequence Viewer
	XP_038964164	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79185	(Get FASTA)	NCBI Sequence Viewer
	EDM02020	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000065108
	ENSRNOP00000065108.1
	ENSRNOP00000079773
	ENSRNOP00000086703
GenBank Protein	Q6AY56	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001019510 ⟸ NM_001024339

- UniProtKB:

Q6AY56 (UniProtKB/Swiss-Prot), A0A8I6A3U6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MRECISVHVGQAGVQIGNACWELFCLEHGIQADGTFGTQASKINDDDSFTTFFSETGNGKHVPR
AVMVDLEPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGHYTVGKESIDLVLDRIRKLTDA
CSGLQGFLIFHSFGGGTGSGFTSLLMERLSLDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTH
TTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQ
TNLVPYPRIHFPLVTYAPIVSAEKAYHEQLSVAEITSSCFEPNSQMVKCDPRHGKYMACCMLYR
GDVVPKDVNVAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAI
AEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGTDSFEEENEGEE
F

hide sequence

RefSeq Acc Id:

XP_017448333 ⟸ XM_017592844

- Peptide Label:

isoform X1

- Sequence:

show sequence

MVDLEPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGHYTVGKESIDLVLDRIRKLTDACS
GLQGFLIFHSFGGGTGSGFTSLLMERLSLDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTT
LEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTN
LVPYPRIHFPLVTYAPIVSAEKAYHEQLSVAEITSSCFEPNSQMVKCDPRHGKYMACCMLYRGD
VVPKDVNVAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAE
AWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGTDSFEEENEGEEF

hide sequence

Ensembl Acc Id:

ENSRNOP00000065108 ⟸ ENSRNOT00000074096

RefSeq Acc Id:	XP_038964164 ⟸ XM_039108236
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I5ZN97 (UniProtKB/TrEMBL), A0A8I6A3U6 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000079773 ⟸ ENSRNOT00000094482

Ensembl Acc Id:

ENSRNOP00000110999 ⟸ ENSRNOT00000131696

Ensembl Acc Id:

ENSRNOP00000086703 ⟸ ENSRNOT00000102041

Protein Domains

Tubulin/FtsZ 2-layer sandwich Tubulin/FtsZ GTPase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AY56-F1-model_v2	AlphaFold	Q6AY56	1-449	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693362

Promoter ID:

EPDNEW_R3886

Type:

initiation region

Name:

Tuba8_1

Description:

tubulin, alpha 8

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	153,774,500 - 153,774,560	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1566041	AgrOrtholog
BioCyc Gene	G2FUF-43185	BioCyc
Ensembl Genes	ENSRNOG00000048169	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000074096	ENTREZGENE
	ENSRNOT00000074096.3	UniProtKB/Swiss-Prot
	ENSRNOT00000094482	ENTREZGENE
	ENSRNOT00000102041	ENTREZGENE
Gene3D-CATH	1.10.287.600	UniProtKB/Swiss-Prot
	3.30.1330.20	UniProtKB/Swiss-Prot
	3.40.50.1440	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7131106	IMAGE-MGC_LOAD
InterPro	Alpha_tubulin	UniProtKB/Swiss-Prot
	Tub_FtsZ_C	UniProtKB/Swiss-Prot
	Tubulin	UniProtKB/Swiss-Prot
	Tubulin/FtsZ_2-layer-sand-dom	UniProtKB/Swiss-Prot
	Tubulin/FtsZ_C_sf	UniProtKB/Swiss-Prot
	Tubulin/FtsZ_GTPase_sf	UniProtKB/Swiss-Prot
	Tubulin_C	UniProtKB/Swiss-Prot
	Tubulin_CS	UniProtKB/Swiss-Prot
	Tubulin_FtsZ_GTPase	UniProtKB/Swiss-Prot
KEGG Report	rno:500377	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94229	IMAGE-MGC_LOAD
NCBI Gene	500377	ENTREZGENE
PANTHER	PTHR11588	UniProtKB/Swiss-Prot
Pfam	Tubulin	UniProtKB/Swiss-Prot
	Tubulin_C	UniProtKB/Swiss-Prot
PhenoGen	Tuba8	PhenoGen
PRINTS	ALPHATUBULIN	UniProtKB/Swiss-Prot
	TUBULIN	UniProtKB/Swiss-Prot
PROSITE	TUBULIN	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000048169	RatGTEx
SMART	Tubulin	UniProtKB/Swiss-Prot
	Tubulin_C	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF52490	UniProtKB/Swiss-Prot
	SSF55307	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZN97	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A1R5_RAT	UniProtKB/TrEMBL
	A0A8I6A3U6	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0M6P7_RAT	UniProtKB/TrEMBL
	Q6AY56	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-01-09	Tuba8	tubulin, alpha 8	LOC682022	similar to Tubulin alpha-8 chain (Alpha-tubulin 8)	Data merged from RGD:1588144	1643240	APPROVED
2007-05-17	Tuba8	tubulin, alpha 8	LOC500377	similar to Tubulin alpha-8 chain (Alpha-tubulin 8)	Symbol and Name updated	1624988	APPROVED
2006-11-19	LOC682022	similar to Tubulin alpha-8 chain (Alpha-tubulin 8)			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-02-09	LOC500377	similar to Tubulin alpha-8 chain (Alpha-tubulin 8)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)