Advanced Search (OLGA)

Gene: Galnt17 (polypeptide N-acetylgalactosaminyltransferase 17) Rattus norvegicus

Analyze

Symbol:

Galnt17

Name:

polypeptide N-acetylgalactosaminyltransferase 17

RGD ID:

1563452

Description:

Predicted to enable polypeptide N-acetylgalactosaminyltransferase activity. Predicted to be involved in protein O-linked glycosylation. Predicted to be located in Golgi membrane. Predicted to be active in Golgi apparatus. Orthologous to human GALNT17 (polypeptide N-acetylgalactosaminyltransferase 17); PARTICIPATES IN O-linked glycan biosynthetic pathway; INTERACTS WITH atrazine; bisphenol A; dimethylarsinic acid.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

pt-GalNAc-T; putative polypeptide N-acetylgalactosaminyltransferase-like protein 3; Wbscr17; Williams-Beuren syndrome chromosome region 17; Williams-Beuren syndrome chromosome region 17 homolog; Williams-Beuren syndrome chromosome region 17 homolog (human)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	30,959,460 - 31,418,150 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	30,959,447 - 31,418,149 (+)	Ensembl				GRCr8
mRatBN7.2	12	25,323,230 - 25,781,897 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	25,322,701 - 25,781,290 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	26,477,975 - 26,925,536 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	27,088,448 - 27,536,028 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	26,147,336 - 26,596,407 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	28,381,879 - 29,268,457 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	28,381,982 - 29,268,073 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	31,188,190 - 31,212,714 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Rnor_5.0	12	30,342,777 - 30,922,308 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	26,294,280 - 26,820,070 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	27,052,564 - 27,503,433 (+)	NCBI		Celera
Cytogenetic Map	12	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,4,4'-trichlorobiphenyl (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2-palmitoylglycerol (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

amiodarone (ISO)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

atrazine (EXP)

belinostat (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

Butylbenzyl phthalate (ISO)

choline (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

dimethylarsinic acid (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

ethanol (ISO)

folic acid (ISO)

gentamycin (EXP)

hexane (EXP)

L-methionine (ISO)

lead(0) (ISO)

methapyrilene (ISO)

N,N-diethyl-m-toluamide (EXP)

PCB138 (ISO)

perfluorohexanesulfonic acid (ISO)

permethrin (EXP)

pioglitazone (ISO)

potassium dichromate (ISO)

resveratrol (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

triclosan (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

protein O-linked glycosylation (IBA)

Cellular Component

Golgi apparatus (IBA)

Golgi membrane (IEA)

Molecular Function

carbohydrate binding (IEA)

glycosyltransferase activity (IEA)

metal ion binding (IEA)

polypeptide N-acetylgalactosaminyltransferase activity (IBA,IEA)

transferase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

O-linked glycan biosynthetic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:15744064

Genomics

Comparative Map Data

Galnt17
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	30,959,460 - 31,418,150 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	30,959,447 - 31,418,149 (+)	Ensembl				GRCr8
mRatBN7.2	12	25,323,230 - 25,781,897 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	25,322,701 - 25,781,290 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	26,477,975 - 26,925,536 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	27,088,448 - 27,536,028 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	26,147,336 - 26,596,407 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	28,381,879 - 29,268,457 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	28,381,982 - 29,268,073 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	31,188,190 - 31,212,714 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Rnor_5.0	12	30,342,777 - 30,922,308 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	26,294,280 - 26,820,070 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	27,052,564 - 27,503,433 (+)	NCBI		Celera
Cytogenetic Map	12	q12	NCBI

GALNT17
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	71,132,144 - 71,713,599 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	71,132,144 - 71,713,600 (+)	Ensembl			hg38	GRCh38
GRCh37	7	70,597,130 - 71,178,584 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	70,235,725 - 70,816,519 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	7	70,042,439 - 70,623,235	NCBI
Celera	7	63,974,185 - 64,554,073 (+)	NCBI		Celera
Cytogenetic Map	7	q11.22	NCBI
HuRef	7	66,769,042 - 67,348,742 (+)	NCBI		HuRef
CHM1_1	7	70,692,646 - 71,273,866 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	72,350,331 - 72,931,329 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	69,931,481 - 70,512,471 (+)	NCBI

Galnt17
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	130,903,181 - 131,336,360 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	130,900,923 - 131,337,335 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	130,874,343 - 131,307,522 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	130,872,082 - 131,308,497 (-)	Ensembl			mm10	GRCm38
MGSCv37	5	131,350,821 - 131,783,392 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	131,159,654 - 131,591,621 (-)	NCBI		MGSCv36	mm8
MGSCv36	5	129,354,156 - 129,800,320 (-)	NCBI		MGSCv36	mm8
Celera	5	127,887,923 - 128,321,088 (-)	NCBI		Celera
Cytogenetic Map	5	G2	NCBI
cM Map	5	70.66	NCBI

Galnt17
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955456	9,614,122 - 10,066,311 (-)	Ensembl
ChiLan1.0	NW_004955456	9,612,734 - 10,067,396 (-)	NCBI	ChiLan1.0	ChiLan1.0

GALNT17
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	84,187,762 - 84,770,109 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	132,514,913 - 133,097,263 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	66,355,754 - 66,937,769 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	79,027,348 - 79,589,197 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	79,027,531 - 79,587,744 (+)	Ensembl			panPan2	panpan1.1

GALNT17
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	2,131,465 - 2,563,823 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	2,132,189 - 2,564,042 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	3,826,037 - 4,262,103 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	1,938,385 - 2,381,618 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	1,942,357 - 2,381,649 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	1,867,785 - 2,303,449 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	1,880,110 - 2,315,921 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	2,047,393 - 2,483,704 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Galnt17
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	127,257,578 - 127,613,342 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936543	6,423,874 - 6,778,798 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936543	6,423,485 - 6,779,179 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GALNT17
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	15,026,772 - 15,450,615 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	3	15,026,350 - 15,450,625 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	15,282,879 - 15,666,048 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GALNT17
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	28	3,637,321 - 4,227,765 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	28	3,638,790 - 4,227,497 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666070	12,368,906 - 12,959,570 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Galnt17
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	9,640,736 - 10,129,920 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624740	9,640,962 - 10,131,238 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Galnt17
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	16	22,649,438 - 23,097,402 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Galnt17
3328 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	87
Count of miRNA genes:	72
Interacting mature miRNAs:	73
Transcripts:	ENSRNOT00000028939
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	24805022	52308831	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	11200494	52308831	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
8693635	Alc28	Alcohol consumption QTL 28	2.7	0.439	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	50386405	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	25989355	52308831	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	3489416	48489416	Rat
1331739	Hrtrt14	Heart rate QTL 14	3.56232		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	12	1	38687564	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	18473041	52308831	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200497	52308831	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	15264248	52308831	Rat
61331	Eau2	Experimental allergic uveoretinitis QTL 2		0.0005	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	12	1	33700600	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	11743528	52308831	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	1	38635130	Rat
70169	Eae13	Experimental allergic encephalomyelitis QTL 13		0.032	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	12	29775522	42298555	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	17464979	46784661	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	16187438	52308831	Rat
8693658	Alc33	Alcohol consumption QTL 33	2.1	0.68	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	49212240	Rat
1331787	Rf41	Renal function QTL 41	2.998		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	12	1	33700556	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	16135029	52308831	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	51213550	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	11200494	52308831	Rat
61416	Pia4	Pristane induced arthritis QTL 4	8.4		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	12	18749469	36488809	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	11200494	52308831	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	41361854	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	18749469	34312613	Rat
1300157	Rf21	Renal function QTL 21	4.4		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	12	29636637	37764351	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	2747694	47747694	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	18473041	52308831	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	3087180	48087180	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7243862	Mcs30	Mammary carcinoma susceptibility QTL 30	8.62		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	12	5633306	50633306	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	16135029	52308831	Rat
2293086	Iddm30	Insulin dependent diabetes mellitus QTL 30	3.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	7901625	33938215	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
1331755	Bp219	Blood pressure QTL 219	3.041		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	33700556	Rat

Markers in Region

D12Rat99

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	12	31,371,693 - 31,371,920 (+)	Marker Load Pipeline
mRatBN7.2	12	25,735,464 - 25,735,691 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	28,959,306 - 28,959,532	NCBI	Rnor6.0
Rnor_5.0	12	30,910,390 - 30,910,616	UniSTS	Rnor5.0
RGSC_v3.4	12	26,768,617 - 26,768,844	RGD	RGSC3.4
RGSC_v3.4	12	26,768,618 - 26,768,844	UniSTS	RGSC3.4
RGSC_v3.1	12	26,631,829 - 26,632,237	RGD
FHH x ACI Map	12	13.38	UniSTS
FHH x ACI Map	12	13.38	RGD
Cytogenetic Map	12	q12	UniSTS

D12Got58

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	25,652,468 - 25,652,613 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	28,876,845 - 28,876,989	NCBI	Rnor6.0
Rnor_5.0	12	30,827,856 - 30,828,000	UniSTS	Rnor5.0
RGSC_v3.4	12	26,635,630 - 26,635,775	RGD	RGSC3.4
RGSC_v3.4	12	26,635,631 - 26,635,775	UniSTS	RGSC3.4
Celera	12	27,377,996 - 27,378,140	UniSTS
RGSC_v3.1	12	26,498,847 - 26,498,991	RGD
RH 3.4 Map	12	415.4	UniSTS
RH 3.4 Map	12	415.4	RGD
RH 2.0 Map	12	311.8	RGD
Cytogenetic Map	12	q12	UniSTS

D12Got53

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	25,643,050 - 25,643,216 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	28,858,733 - 28,858,898	NCBI	Rnor6.0
Rnor_5.0	12	30,814,591 - 30,814,756	UniSTS	Rnor5.0
RGSC_v3.4	12	26,627,382 - 26,627,549	RGD	RGSC3.4
RGSC_v3.4	12	26,627,384 - 26,627,549	UniSTS	RGSC3.4
Celera	12	27,368,598 - 27,368,763	UniSTS
RGSC_v3.1	12	26,490,598 - 26,490,765	RGD
RH 3.4 Map	12	419.4	UniSTS
RH 3.4 Map	12	419.4	RGD
Cytogenetic Map	12	q12	UniSTS

D12Got56

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	25,652,427 - 25,652,606 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	28,876,804 - 28,876,982	NCBI	Rnor6.0
Rnor_5.0	12	30,827,815 - 30,827,993	UniSTS	Rnor5.0
RGSC_v3.4	12	26,635,591 - 26,635,768	RGD	RGSC3.4
RGSC_v3.4	12	26,635,590 - 26,635,768	UniSTS	RGSC3.4
Celera	12	27,377,955 - 27,378,133	UniSTS
RGSC_v3.1	12	26,498,807 - 26,498,984	RGD
RH 3.4 Map	12	421.8	UniSTS
RH 3.4 Map	12	421.8	RGD
Cytogenetic Map	12	q12	UniSTS

BE097146

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	25,394,282 - 25,394,434 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	28,604,874 - 28,605,025	NCBI	Rnor6.0
Rnor_5.0	12	30,568,078 - 30,568,229	UniSTS	Rnor5.0
RGSC_v3.4	12	26,365,120 - 26,365,271	UniSTS	RGSC3.4
Celera	12	27,122,910 - 27,123,061	UniSTS
RH 3.4 Map	12	436.4	UniSTS
Cytogenetic Map	12	q12	UniSTS

AU048219

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	X	6,207,067 - 6,207,180 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	28,494,138 - 28,494,250	NCBI	Rnor6.0
Rnor_5.0	12	30,456,500 - 30,456,612	UniSTS	Rnor5.0
Celera	X	6,696,992 - 6,697,106	UniSTS
Cytogenetic Map	12	q12	UniSTS

AU048013

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	25,585,800 - 25,585,976 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	28,802,005 - 28,802,180	NCBI	Rnor6.0
Rnor_5.0	12	30,758,291 - 30,758,466	UniSTS	Rnor5.0
RGSC_v3.4	12	26,557,685 - 26,557,860	UniSTS	RGSC3.4
Celera	12	27,312,318 - 27,312,493	UniSTS
Cytogenetic Map	12	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
12	12	67	151	86	85	54	31	54	6	266	131	11	130	61	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025112	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017598300	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089218	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB040671	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000076101 ⟹ ENSRNOP00000067894

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	30,959,447 - 31,418,149 (+)	Ensembl
mRatBN7.2 Ensembl	12	25,322,701 - 25,781,290 (+)	Ensembl
Rnor_6.0 Ensembl	12	28,381,982 - 28,971,289 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076194 ⟹ ENSRNOP00000068113

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	12	29,266,602 - 29,268,073 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000124260 ⟹ ENSRNOP00000106915

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	30,979,700 - 31,417,517 (+)	Ensembl

RefSeq Acc Id:

NM_001025112 ⟹ NP_001020283

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	30,959,460 - 31,418,118 (+)	NCBI
mRatBN7.2	12	25,323,230 - 25,781,897 (+)	NCBI
Rnor_6.0	12	28,382,331 - 29,268,073 (+)	NCBI
Rnor_5.0	12	30,342,777 - 30,922,308 (+)	NCBI
Rnor_5.0	12	31,188,190 - 31,212,714 (+)	NCBI
RGSC_v3.4	12	26,294,280 - 26,820,070 (+)	RGD
Celera	12	27,052,564 - 27,503,433 (+)	RGD

Sequence:

show sequence

ATGGCTTCACTGAGGAGAGTCAAAGTGTTGTTGGTGTTGAACTTGATCGCGGTGGCCGGCTTCG
TGATCTTTTTGGCTAAGTGTCGGCCTATCGCGGTGCGCAGCGGAGACGCCTTCCACGAGATCCG
GCCTCGCGCAGAGGTGGCCAACCTCAGCGCGCACAGTGCCAGCCCCATCCAGGATGCAGTCCTG
AAGCGCTTGTCGCTGCTGGAGGACATCGTCTACCGGCAACTTAATGGCTTATCTAAATCCCTCG
GGCTCATCGAAGGGTATGGTGGGCGGGGCAAAGGAGGCCTTCCTGCCACCCTTTCCCCCTCTGA
AGAAGAAAAAGCCAAAGGACCTCATGAGAAGTATGGCTACAATTCCTACCTCAGTGAAAAGATC
TCCTTGGACCGGTCTATTCCAGATTATCGCCCTACCAAGTGTAAGGAGCTCAAATACTCCAAGG
AGTTACCCCAGATATCCATCATCTTCATCTTCGTGAATGAGGCCCTGTCAGTGATACTGCGGTC
AGTCCACAGCGCCGTCAATCACACGCCCACACACCTGCTGAAGGAGATTATCCTGGTGGATGAC
AACAGCGATGAAGAGGAGCTGAAGGCCCCCCTGGAGGAATATGTCCACAAACGCTATCCTGGGC
TGGTGAAGGTGGTACGCAATCAAAAGAGAGAGGGCCTGATCCGAGCACGCATCGAGGGCTGGAA
GGTGGCCACTGGCCAGGTCACTGGCTTTTTCGACGCTCACGTGGAATTCACTGCTGGCTGGGCT
GAGCCCGTTCTGTCCCGCATCCAGGAAAACCGGAAGCGGGTCATCCTCCCCTCCATCGACAACA
TCAAGCAGGACAACTTCGAAGTACAGCGCTATGAGAACTCCGCCCACGGGTACAGCTGGGAGCT
GTGGTGCATGTACATCAGCCCCCCGAAAGACTGGTGGGACGCCGGAGATCCCTCTCTCCCCATC
AGGACACCAGCCATGATTGGCTGCTCGTTTGTGGTCAACAGGAAATTCTTTGGTGAAATTGGTC
TGCTGGACCCTGGGATGGATGTGTATGGAGGAGAGAATATTGAACTTGGAATCAAGGTATGGCT
CTGTGGCGGCAGCATGGAGGTCCTTCCGTGTTCAAGGGTGGCCCACATTGAGCGGAAGAAGAAA
CCGTATAACAGCAACATCGGCTTCTATACCAAGAGGAACGCACTCCGAGTAGCCGAGGTCTGGA
TGGATGACTACAAGTCACATGTGTACATAGCGTGGAATCTGCCTCTGGAGAATCCAGGCATCGA
TATCGGCGACGTCTCAGAAAGAAAGGCATTAAGGAAAAGTTTGAAGTGTAAGAACTTCCAGTGG
TACTTGGACCATGTTTACCCGGAAATGAGAAGATACAACAACACCATCGCATACGGGGAGCTTC
GTAATAACAAGGCCAAGGATGTCTGCCTGGACCAGGGGCCACTGGAAAACCACACAGCAATACT
CTACCCATGCCACGGTTGGGGACCACAGCTCGCCCGCTACACCAAGGAAGGCTTCCTGCACTTG
GGTGCTCTGGGGACCACCACTCTCCTCCCTGATACCCGCTGCCTGGTAGACAACTCCAAGAGCC
GGTTGCCGCAGCTCCTGGATTGTGACAAGGTCAAGAGTAGCTTGTACAAGCGTTGGAACTTCAT
CCAGAATGGAGCCATCATGAATAAGGGCACAGGGCGCTGCCTAGAAGTGGAGAACCGGGGCCTG
GCCGGTATCGACCTAATCCTTCGGAGCTGTACAGGACAGAGATGGACAATCAAGAATCCCATTA
AGTAG

hide sequence

RefSeq Acc Id:

XM_039089218 ⟹ XP_038945146

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	30,977,517 - 31,418,150 (+)	NCBI
mRatBN7.2	12	25,342,459 - 25,780,036 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001020283	(Get FASTA)	NCBI Sequence Viewer
	XP_038945146	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAD91088	(Get FASTA)	NCBI Sequence Viewer
	EDM13454	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000067894
	ENSRNOP00000067894.2
	ENSRNOP00000106915
	ENSRNOP00000106915.1

RefSeq Acc Id:

NP_001020283 ⟸ NM_001025112

- UniProtKB:

Q5CD99 (UniProtKB/TrEMBL), A0A096MIV6 (UniProtKB/TrEMBL), A0A9K3Y768 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASLRRVKVLLVLNLIAVAGFVIFLAKCRPIAVRSGDAFHEIRPRAEVANLSAHSASPIQDAVL
KRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPSEEEKAKGPHEKYGYNSYLSEKI
SLDRSIPDYRPTKCKELKYSKELPQISIIFIFVNEALSVILRSVHSAVNHTPTHLLKEIILVDD
NSDEEELKAPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGQVTGFFDAHVEFTAGWA
EPVLSRIQENRKRVILPSIDNIKQDNFEVQRYENSAHGYSWELWCMYISPPKDWWDAGDPSLPI
RTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIKVWLCGGSMEVLPCSRVAHIERKKK
PYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLPLENPGIDIGDVSERKALRKSLKCKNFQW
YLDHVYPEMRRYNNTIAYGELRNNKAKDVCLDQGPLENHTAILYPCHGWGPQLARYTKEGFLHL
GALGTTTLLPDTRCLVDNSKSRLPQLLDCDKVKSSLYKRWNFIQNGAIMNKGTGRCLEVENRGL
AGIDLILRSCTGQRWTIKNPIK

hide sequence

Ensembl Acc Id:

ENSRNOP00000068113 ⟸ ENSRNOT00000076194

Ensembl Acc Id:

ENSRNOP00000067894 ⟸ ENSRNOT00000076101

RefSeq Acc Id:	XP_038945146 ⟸ XM_039089218
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000106915 ⟸ ENSRNOT00000124260

Protein Domains

Ricin B lectin

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A096MIV6-F1-model_v2	AlphaFold	A0A096MIV6	1-422	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1563452	AgrOrtholog
BioCyc Gene	G2FUF-19538	BioCyc
Ensembl Genes	ENSRNOG00000024435	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000076101	ENTREZGENE
	ENSRNOT00000076101.3	UniProtKB/TrEMBL
	ENSRNOT00000124260	ENTREZGENE
	ENSRNOT00000124260.1	UniProtKB/TrEMBL
Gene3D-CATH	2.80.10.50	UniProtKB/TrEMBL
	Spore Coat Polysaccharide Biosynthesis Protein SpsA, Chain A	UniProtKB/TrEMBL
InterPro	GalNAc-T	UniProtKB/TrEMBL
	Glyco_trans_2	UniProtKB/TrEMBL
	Nucleotide-diphossugar_trans	UniProtKB/TrEMBL
	Ricin_B-like_lectins	UniProtKB/TrEMBL
	Ricin_B_lectin	UniProtKB/TrEMBL
KEGG Report	rno:288611	UniProtKB/TrEMBL
NCBI Gene	288611	ENTREZGENE
PANTHER	N-ACETYLGALACTOSAMINYLTRANSFERASE	UniProtKB/TrEMBL
	POLYPEPTIDE N-ACETYLGALACTOSAMINYLTRANSFERASE 17	UniProtKB/TrEMBL
Pfam	Glycos_transf_2	UniProtKB/TrEMBL
	Ricin_B_lectin	UniProtKB/TrEMBL
PhenoGen	Galnt17	PhenoGen
PROSITE	RICIN_B_LECTIN	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000024435	RatGTEx
SMART	RICIN	UniProtKB/TrEMBL
Superfamily-SCOP	RicinB_like	UniProtKB/TrEMBL
	SSF53448	UniProtKB/TrEMBL
UniProt	A0A096MIV6	ENTREZGENE
	A0A9K3Y768	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LXH5_RAT	UniProtKB/TrEMBL
	Q5CD99	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	A0A096MIV6	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-05-12	Galnt17	polypeptide N-acetylgalactosaminyltransferase 17	Wbscr17	Williams-Beuren syndrome chromosome region 17	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-02-04	Wbscr17	Williams-Beuren syndrome chromosome region 17	Wbscr17	Williams-Beuren syndrome chromosome region 17 homolog (human)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-04	Wbscr17	Williams-Beuren syndrome chromosome region 17 homolog (human)	Wbscr17	Williams-Beuren syndrome chromosome region 17 homolog	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	Wbscr17	Williams-Beuren syndrome chromosome region 17 homolog			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)