Advanced Search (OLGA)

Gene: Sumf2 (sulfatase modifying factor 2) Rattus norvegicus

Analyze

Symbol:

Sumf2

Name:

sulfatase modifying factor 2

RGD ID:

1563253

Description:

Predicted to enable identical protein binding activity. Predicted to be active in endoplasmic reticulum lumen. Orthologous to human SUMF2 (sulfatase modifying factor 2); INTERACTS WITH 1,3-dinitrobenzene; 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

inactive C-alpha-formylglycine-generating enzyme 2; MGC108793; sulfatase-modifying factor 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SUMF2 (sulfatase modifying factor 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Sumf2 (sulfatase modifying factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Sumf2 (sulfatase modifying factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SUMF2 (sulfatase modifying factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SUMF2 (sulfatase modifying factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Sumf2 (sulfatase modifying factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SUMF2 (sulfatase modifying factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SUMF2 (sulfatase modifying factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Sumf2 (sulfatase modifying factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Sumf2 (sulfatase modifying factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	SUMF2 (sulfatase modifying factor 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Sumf2 (sulfatase modifying factor 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	sumf2 (sulfatase modifying factor 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	sumf2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	32,489,671 - 32,507,941 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	32,489,671 - 32,507,928 (-)	Ensembl				GRCr8
mRatBN7.2	12	26,853,561 - 26,871,835 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	26,853,200 - 26,871,816 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	27,991,132 - 28,009,042 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	28,601,670 - 28,619,581 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	27,663,155 - 27,681,067 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	30,465,025 - 30,490,683 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	30,464,676 - 30,491,102 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	32,407,454 - 32,432,604 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	28,003,479 - 28,028,905 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	28,559,621 - 28,577,528 (-)	NCBI		Celera
Cytogenetic Map	12	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

mucosulfatidosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1,3-dinitrobenzene (EXP)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

acrolein (ISO)

acrylamide (EXP,ISO)

amphetamine (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

Butylbenzyl phthalate (EXP)

cadmium dichloride (ISO)

carbon nanotube (ISO)

cisplatin (ISO)

Dibutyl phosphate (ISO)

doxorubicin (ISO)

flutamide (EXP)

folic acid (ISO)

gallic acid (ISO)

gentamycin (EXP)

inulin (ISO)

ivermectin (ISO)

leflunomide (EXP)

nefazodone (EXP)

okadaic acid (ISO)

ozone (ISO)

paracetamol (EXP)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

resveratrol (ISO)

rotenone (ISO)

sodium arsenite (ISO)

Soman (EXP)

tetrachloromethane (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

tunicamycin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

endoplasmic reticulum (IEA,ISO)

endoplasmic reticulum lumen (IEA,ISO)

Molecular Function

identical protein binding (IEA,ISO)

metal ion binding (IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15962010	PMID:18266766	PMID:26722390

Genomics

Comparative Map Data

Sumf2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	32,489,671 - 32,507,941 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	32,489,671 - 32,507,928 (-)	Ensembl				GRCr8
mRatBN7.2	12	26,853,561 - 26,871,835 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	26,853,200 - 26,871,816 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	27,991,132 - 28,009,042 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	28,601,670 - 28,619,581 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	27,663,155 - 27,681,067 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	30,465,025 - 30,490,683 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	30,464,676 - 30,491,102 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	32,407,454 - 32,432,604 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	28,003,479 - 28,028,905 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	28,559,621 - 28,577,528 (-)	NCBI		Celera
Cytogenetic Map	12	q13	NCBI

SUMF2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	56,064,286 - 56,087,946 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	56,064,002 - 56,080,670 (+)	Ensembl			hg38	GRCh38
GRCh37	7	56,131,979 - 56,148,363 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	56,099,411 - 56,115,859 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	7	55,906,166 - 55,922,566	NCBI
Celera	7	67,185,316 - 67,201,269 (+)	NCBI		Celera
Cytogenetic Map	7	p11.2	NCBI
HuRef	7	55,945,700 - 55,961,808 (+)	NCBI		HuRef
CHM1_1	7	56,134,940 - 56,151,380 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	56,224,110 - 56,247,761 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	56,136,164 - 56,152,612 (+)	NCBI

Sumf2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	129,875,807 - 129,892,275 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	129,875,827 - 129,892,891 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	129,846,990 - 129,863,951 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	129,846,986 - 129,864,050 (+)	Ensembl			mm10	GRCm38
MGSCv37	5	130,322,866 - 130,339,827 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	130,131,699 - 130,148,660 (+)	NCBI		MGSCv36	mm8
Celera	5	126,860,515 - 126,861,831 (+)	NCBI		Celera
Cytogenetic Map	5	G1.3	NCBI
cM Map	5	68.26	NCBI

Sumf2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955456	8,238,318 - 8,251,366 (+)	Ensembl
ChiLan1.0	NW_004955456	8,238,301 - 8,251,682 (+)	NCBI	ChiLan1.0	ChiLan1.0

SUMF2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	60,916,368 - 60,932,779 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	109,241,093 - 109,257,505 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	56,677,230 - 56,693,639 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	57,099,758 - 57,116,307 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2

SUMF2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	557,774 - 568,564 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	557,855 - 567,801 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	2,257,085 - 2,268,031 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	361,425 - 372,393 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	361,490 - 375,995 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	305,184 - 316,139 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	299,267 - 310,244 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	470,498 - 481,426 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Sumf2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	126,149,801 - 126,160,458 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936543	7,875,523 - 7,886,666 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936543	7,875,523 - 7,886,619 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SUMF2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	16,830,922 - 16,843,584 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	3	16,819,761 - 16,843,573 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	17,082,854 - 17,095,321 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SUMF2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	2,701,803 - 2,715,556 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666041	179,903,752 - 179,918,463 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sumf2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	8,259,062 - 8,269,845 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624740	8,259,131 - 8,279,600 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Sumf2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	16	24,155,444 - 24,173,275 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Sumf2
247 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	86
Count of miRNA genes:	74
Interacting mature miRNAs:	82
Transcripts:	ENSRNOT00000001224
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	24805022	52308831	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	11200494	52308831	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
8693635	Alc28	Alcohol consumption QTL 28	2.7	0.439	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	50386405	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	25989355	52308831	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	3489416	48489416	Rat
1331739	Hrtrt14	Heart rate QTL 14	3.56232		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	12	1	38687564	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	18473041	52308831	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200497	52308831	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	15264248	52308831	Rat
61331	Eau2	Experimental allergic uveoretinitis QTL 2		0.0005	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	12	1	33700600	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	11743528	52308831	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	1	38635130	Rat
70169	Eae13	Experimental allergic encephalomyelitis QTL 13		0.032	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	12	29775522	42298555	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	17464979	46784661	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	16187438	52308831	Rat
8693658	Alc33	Alcohol consumption QTL 33	2.1	0.68	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	49212240	Rat
1331787	Rf41	Renal function QTL 41	2.998		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	12	1	33700556	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	16135029	52308831	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	51213550	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	11200494	52308831	Rat
61416	Pia4	Pristane induced arthritis QTL 4	8.4		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	12	18749469	36488809	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	11200494	52308831	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	41361854	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	18749469	34312613	Rat
1300157	Rf21	Renal function QTL 21	4.4		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	12	29636637	37764351	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	2747694	47747694	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	18473041	52308831	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	3087180	48087180	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7243862	Mcs30	Mammary carcinoma susceptibility QTL 30	8.62		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	12	5633306	50633306	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	16135029	52308831	Rat
2293086	Iddm30	Insulin dependent diabetes mellitus QTL 30	3.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	7901625	33938215	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
1331755	Bp219	Blood pressure QTL 219	3.041		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	33700556	Rat

Markers in Region

BF399653

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	26,870,403 - 26,870,548 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	30,489,252 - 30,489,396	NCBI	Rnor6.0
Rnor_5.0	12	32,431,173 - 32,431,317	UniSTS	Rnor5.0
RGSC_v3.4	12	28,004,766 - 28,004,910	UniSTS	RGSC3.4
Celera	12	28,576,097 - 28,576,241	UniSTS
RH 3.4 Map	12	452.3	UniSTS
Cytogenetic Map	12	q13	UniSTS
Cytogenetic Map	9	q36	UniSTS

RH141366

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	26,853,340 - 26,853,520 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	30,464,805 - 30,464,984	NCBI	Rnor6.0
Rnor_5.0	12	32,407,234 - 32,407,413	UniSTS	Rnor5.0
RGSC_v3.4	12	28,028,946 - 28,029,125	UniSTS	RGSC3.4
Celera	12	28,559,401 - 28,559,580	UniSTS
RH 3.4 Map	12	446.6	UniSTS
Cytogenetic Map	12	q13	UniSTS
Cytogenetic Map	9	q36	UniSTS

RH134402

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	26,872,658 - 26,872,850 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	30,491,507 - 30,491,698	NCBI	Rnor6.0
Rnor_5.0	12	32,433,428 - 32,433,619	UniSTS	Rnor5.0
RGSC_v3.4	12	28,002,464 - 28,002,655	UniSTS	RGSC3.4
RGSC_v3.4	5	8,729,076 - 8,729,267	UniSTS	RGSC3.4
Celera	12	28,578,352 - 28,578,543	UniSTS
Cytogenetic Map	12	q13	UniSTS
Cytogenetic Map	9	q36	UniSTS

BF387881

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	26,865,581 - 26,865,739 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	30,484,432 - 30,484,589	NCBI	Rnor6.0
Rnor_5.0	12	32,426,353 - 32,426,510	UniSTS	Rnor5.0
RGSC_v3.4	12	28,009,473 - 28,009,630	UniSTS	RGSC3.4
Celera	12	28,571,289 - 28,571,446	UniSTS
RH 3.4 Map	12	446.2	UniSTS
Cytogenetic Map	12	q13	UniSTS
Cytogenetic Map	9	q36	UniSTS

RH138720

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	26,853,572 - 26,853,694 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	30,465,037 - 30,465,158	NCBI	Rnor6.0
Rnor_5.0	12	32,407,466 - 32,407,587	UniSTS	Rnor5.0
RGSC_v3.4	12	28,028,772 - 28,028,893	UniSTS	RGSC3.4
Celera	12	28,559,633 - 28,559,754	UniSTS
RH 3.4 Map	12	449.1	UniSTS
Cytogenetic Map	12	q13	UniSTS
Cytogenetic Map	9	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	161	91	90	59	91	59	6	355	191	11	140	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025125	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC091176	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001224 ⟹ ENSRNOP00000001224

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	26,853,200 - 26,871,816 (-)	Ensembl
Rnor_6.0 Ensembl	12	30,464,676 - 30,491,102 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000093142

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	12	30,465,565 - 30,468,173 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000093294 ⟹ ENSRNOP00000076122

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	32,489,671 - 32,507,928 (-)	Ensembl
mRatBN7.2 Ensembl	12	26,853,200 - 26,871,816 (-)	Ensembl
Rnor_6.0 Ensembl	12	30,465,023 - 30,490,670 (-)	Ensembl

RefSeq Acc Id:

NM_001025125 ⟹ NP_001020296

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	32,489,671 - 32,507,941 (-)	NCBI
mRatBN7.2	12	26,853,561 - 26,871,835 (-)	NCBI
Rnor_6.0	12	30,465,025 - 30,490,683 (-)	NCBI
Rnor_5.0	12	32,407,454 - 32,432,604 (-)	NCBI
RGSC_v3.4	12	28,003,479 - 28,028,905 (+)	RGD
Celera	12	28,559,621 - 28,577,528 (-)	RGD

Sequence:

show sequence

CGGAAAAGACGCATGCGTCCTGAGTTCTGGCTCCTCAGCATGGGTTCCCTGTTCCCTGTCCTGC
TGCTGTGGCTCCTGTCCTGCCCCAGGCTTCAGCTAGGACATGCCCAGGATCCTGCCATGGTGCA
CCTGCCAGGTGGTCGGTTTCTGATGGGGACCAATGCTCCAGACGGCAGAGATGGTGAAGGGCCT
GCCCGGGAAGTGACAGTAAAACCCTTTGCCATTGACGTATTTCCCATCACCAATAAAGACTTCA
GGGAGTTTGTCAGGGAGAAGAAGTACCAGACCGAGGCTGAGGCATTCGGGTGGAGCTTCGTCTT
TGAGGATTTTGTCTCCCCTGAGCTCAGGAAGCAAGCAAATGAGATGCCGGCTGTTCTCTGGTGG
CTACCAGTGCAAAAGGCATTTTGGAGGCAGCCTGCAGGTCCCGGCTCTGGCATCCGAGAGAAAC
TGGAGCTTCCGGTGGTACACGTGAGCTGGAATGACGCTGGTGCTTACTGCGCATGGCGGGGGAA
ACGCTTGCCCACAGAAGAGGAGTGGGAGTTTGCAGCGCGAGGAGGCTTGAAGGGTCAGGTTTAC
CCGTGGGGGAACCAGTTCCAGCTAAACCGCACCAACTTGTGGCAGGGAAAGTTCCCCAAGGGTG
ACAGAGCTGAAGATGGTTTTCATGGACTGTCACCAGTGAACGCTTTCCCCCCACAGAACAACTA
CGGGTTATATGACCTCATGGGCAATGTGTGGGAATGGACAGCGTCCACATACCAAGCTGCTGGC
CAGGACATGCGTGTCCTCCGGGGGGCATCATGGATCGACACCGCAGACGGCTCTGCTAATCACC
GGGCTCGGGTCACCACCAGGATGGGCAATACTCCGGATTCAGCCTCAGACAACCTGGGCTTCCG
CTGCGCTTCCAGTGAAGGCAGGCTGAAGGAGGATCTGTGAGCGGCCAGACAGAGACGGAGAAAG
CACCCCCTCAGTACTGTCTCTCCCTGACCAGATTCCAGAGGCAGCTGGACACCAAGCTCATCCG
TCTGAGGGATGGCCTTTTGAGCCCCTCCCCTTTGACAGACAACCTCCTAAGGACAGAAGAACAC
TCAGACCCCAAGAAGGGACTGCCATCGCCTGGAAGATGACCAAGGCTGGGCGCTGGGTTGTCTC
TTAAGTGCAGTATTAAGGACAAAGGAACCAAACGCTCTGGTATCTGGAGCAGTTCTCCAAAAGA
CAGCATTTTAAAGTCTTGCCCTTTTTGCTTTCTCCCGAGAAATTTTATAGAAGGAAAATGCTTC
CTTTGTGAGATGGCACCAAAGCCTGCCTTGCTGCTGGAACCTAGCCTCGATGTCCTTTGAAATG
GGATACTCGTGTGGCTACTGGTCTCGAACTCTCCGTCCTCCTACCTCAGCTTCCTGAGTGCTGG
GATTATATACAATACCCACTGTTAAAAGGCTCCAGTAGAGCAAACGATTTACAAGGTG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001020296	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH91176	(Get FASTA)	NCBI Sequence Viewer
	EDM13486	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000076122
	ENSRNOP00000076122.3

RefSeq Acc Id:	NP_001020296 ⟸ NM_001025125
- Peptide Label:	precursor
- UniProtKB:	A6J0P7 (UniProtKB/TrEMBL), A0A1W2Q645 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRPEFWLLSMGSLFPVLLLWLLSCPRLQLGHAQDPAMVHLPGGRFLMGTNAPDGRDGEGPAREV TVKPFAIDVFPITNKDFREFVREKKYQTEAEAFGWSFVFEDFVSPELRKQANEMPAVLWWLPVQ KAFWRQPAGPGSGIREKLELPVVHVSWNDAGAYCAWRGKRLPTEEEWEFAARGGLKGQVYPWGN QFQLNRTNLWQGKFPKGDRAEDGFHGLSPVNAFPPQNNYGLYDLMGNVWEWTASTYQAAGQDMR VLRGASWIDTADGSANHRARVTTRMGNTPDSASDNLGFRCASSEGRLKEDL hide sequence

Ensembl Acc Id:

ENSRNOP00000076122 ⟸ ENSRNOT00000093294

Ensembl Acc Id:

ENSRNOP00000001224 ⟸ ENSRNOT00000001224

Protein Domains

Sulfatase-modifying factor enzyme-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZTR4-F1-model_v2	AlphaFold	D3ZTR4	1-307	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698589

Promoter ID:

EPDNEW_R9110

Type:

multiple initiation site

Name:

Sumf2_1

Description:

sulfatase modifying factor 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	30,490,657 - 30,490,717	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1563253	AgrOrtholog
BioCyc Gene	G2FUF-19505	BioCyc
Ensembl Genes	ENSRNOG00000000922	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000093294	ENTREZGENE
	ENSRNOT00000093294.3	UniProtKB/TrEMBL
Gene3D-CATH	3.90.1580.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7322044	IMAGE-MGC_LOAD
InterPro	C-type_lectin_fold	UniProtKB/TrEMBL
	Sulfatase_Mod_Factor_Kinase	UniProtKB/TrEMBL
	Sulphatase-mod_factor	UniProtKB/TrEMBL
	SUMF_sf	UniProtKB/TrEMBL
KEGG Report	rno:360800	UniProtKB/TrEMBL
MGC_CLONE	MGC:108793	IMAGE-MGC_LOAD
NCBI Gene	360800	ENTREZGENE
PANTHER	INACTIVE C-ALPHA-FORMYLGLYCINE-GENERATING ENZYME 2	UniProtKB/TrEMBL
	SULFATASE MODIFYING FACTOR 1, 2	UniProtKB/TrEMBL
Pfam	DUF323	UniProtKB/TrEMBL
PhenoGen	Sumf2	PhenoGen
PROSITE	PROKAR_LIPOPROTEIN	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000000922	RatGTEx
Superfamily-SCOP	C-type_lectin_fold	UniProtKB/TrEMBL
UniProt	A0A1W2Q645	ENTREZGENE
	A6J0P7	ENTREZGENE, UniProtKB/TrEMBL
	Q5BK78_RAT	UniProtKB/TrEMBL
UniProt Secondary	A0A1W2Q645	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-02-09	Sumf2	sulfatase modifying factor 2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar