Advanced Search (OLGA)

Gene: C19h4orf51 (similar to human chromosome 4 open reading frame 51) Rattus norvegicus

Analyze

Symbol:

C19h4orf51

Name:

similar to human chromosome 4 open reading frame 51

RGD ID:

1561806

Description:

Orthologous to human C4orf51 (chromosome 4 open reading frame 51); INTERACTS WITH benzo[a]pyrene (ortholog); rifampicin (ortholog).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

hypothetical protein LOC498933; LOC498933; LOC498933; MGC116194; uncharacterized protein C4orf51 homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	45,573,267 - 45,608,796 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	45,573,330 - 45,608,796 (+)	Ensembl				GRCr8
mRatBN7.2	19	28,669,044 - 28,704,512 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	28,669,059 - 28,704,508 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	35,523,847 - 35,559,276 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	36,177,925 - 36,213,366 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	38,413,579 - 38,449,166 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	32,344,078 - 32,380,029 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	32,344,078 - 32,380,025 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	43,240,203 - 43,275,432 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	30,505,305 - 30,540,608 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	28,177,863 - 28,212,691 (+)	NCBI		Celera
Cytogenetic Map	19	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

benzo[a]pyrene (ISO)

rifampicin (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
2.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Genomics

Comparative Map Data

C19h4orf51
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	45,573,267 - 45,608,796 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	45,573,330 - 45,608,796 (+)	Ensembl				GRCr8
mRatBN7.2	19	28,669,044 - 28,704,512 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	28,669,059 - 28,704,508 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	35,523,847 - 35,559,276 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	36,177,925 - 36,213,366 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	38,413,579 - 38,449,166 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	32,344,078 - 32,380,029 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	32,344,078 - 32,380,025 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	43,240,203 - 43,275,432 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	30,505,305 - 30,540,608 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	28,177,863 - 28,212,691 (+)	NCBI		Celera
Cytogenetic Map	19	q11	NCBI

C4orf51
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	145,680,146 - 145,792,443 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	145,680,146 - 145,771,032 (+)	Ensembl			hg38	GRCh38
GRCh37	4	146,601,298 - 146,653,949 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	146,820,806 - 146,873,399 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	4	143,928,891 - 143,981,824 (+)	NCBI		Celera
Cytogenetic Map	4	q31.21	NCBI
HuRef	4	142,331,319 - 142,382,942 (+)	NCBI		HuRef
CHM1_1	4	146,577,928 - 146,631,252 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	4	148,995,961 - 149,108,468 (+)	NCBI		T2T-CHM13v2.0

1700011L22Rik
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	79,937,059 - 79,975,212 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	79,937,060 - 79,975,199 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	8	79,210,430 - 79,248,663 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	79,210,431 - 79,248,570 (-)	Ensembl			mm10	GRCm38
MGSCv37	8	81,734,329 - 81,772,482 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	8	82,106,502 - 82,144,642 (-)	NCBI		MGSCv36	mm8
Celera	8	83,487,532 - 83,525,636 (-)	NCBI		Celera
Cytogenetic Map	8	C1	NCBI
cM Map	8	37.48	NCBI

LOC102007039
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955428	1,500,090 - 1,529,078 (+)	Ensembl
ChiLan1.0	NW_004955428	1,503,025 - 1,543,635 (+)	NCBI	ChiLan1.0	ChiLan1.0

C3H4orf51
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	143,555,555 - 143,628,303 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	143,920,547 - 143,993,278 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	138,022,499 - 138,094,804 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	149,681,583 - 149,732,163 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	149,681,583 - 149,753,557 (+)	Ensembl			panPan2	panpan1.1

C15H4orf51
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	44,255,853 - 44,282,782 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	44,646,899 - 44,748,294 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	44,933,923 - 45,023,000 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
UMICH_Zoey_3.1	15	44,196,384 - 44,296,371 (+)	NCBI		UMICH_Zoey_3.1
UU_Cfam_GSD_1.0	15	44,548,031 - 44,648,475 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

CUNH4orf51
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405301	46,027,012 - 46,055,081 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936535	3,464,407 - 3,467,764 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

C7H4orf51
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	92,241,869 - 92,313,423 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	92,242,439 - 92,283,850 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	71,892,258 - 71,966,137 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

CUNH4orf51
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624853	4,589,551 - 4,627,607 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

C17H4orf51
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	17	20,861,732 - 20,891,287 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in C19h4orf51
327 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	96
Count of miRNA genes:	73
Interacting mature miRNAs:	85
Transcripts:	ENSRNOT00000015541
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	19220689	64220689	Rat
9590298	Uminl5	Urine mineral level QTL 5	3.59	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	19	7997750	52997750	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	36289	74246245	Rat
2313395	Anxrr26	Anxiety related response QTL 26			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	19	44385134	74246245	Rat
61328	Eae8	Experimental allergic encephalomyelitis QTL 8	4		nervous system integrity trait (VT:0010566)	percentage of study population developing experimental autoimmune encephalomyelitis during a period of time (CMO:0001047)	19	41720609	49971820	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	32539615	74246245	Rat
1558656	Prcs1	Prostate cancer susceptibility QTL 1	5		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	19	31287532	51431640	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	31777888	74246245	Rat
9590090	Insglur8	Insulin/glucose ratio QTL 8	10.81	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	19	7997750	52997750	Rat
1554318	Bmd5	Bone mineral density QTL 5	12.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	19	23188586	68188586	Rat
1549835	Tcas7	Tongue tumor susceptibility QTL 7		0.001	tongue integrity trait (VT:0010553)	squamous cell carcinoma of the head and neck tumor number (CMO:0001876)	19	41722546	74246245	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2194317	74246245	Rat
1354633	Bw28	Body weight QTL 28	6.04		body mass (VT:0001259)	body weight (CMO:0000012)	19	40727092	54856850	Rat
61407	Scl12	Serum cholesterol level QTL 12		0.001	blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	19	30099383	47207961	Rat
8552935	Pigfal10	Plasma insulin-like growth factor 1 level QTL 10	5.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	19	7997750	52997750	Rat
631840	Niddm38	Non-insulin dependent diabetes mellitus QTL 38	3.86		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	19	10329076	74246245	Rat
1358200	Insglur2	Insulin/glucose ratio QTL 2	4.1		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	19	5748064	50748064	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	32365311	74246245	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	24093973	69093973	Rat
2303628	Vencon9	Ventilatory control QTL 9		0.005	respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	19	23188586	68188586	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10833618	74246245	Rat
9590250	Scort11	Serum corticosterone level QTL 11	23.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	7997750	52997750	Rat
1354607	Gmadr1	Adrenal mass QTL 1	5.83		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	19	40727092	54856850	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	20109306	65109306	Rat
1354600	Salc2	Saline consumption QTL 2	9.91	0.001	drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	19	40727092	54856850	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2194317	74246245	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
10	9	27	47	48	45	19	33	19	6	122	82	1	26	3	54	26	2	2

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025764	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063278188	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC106702	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC098038	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000015541 ⟹ ENSRNOP00000015541

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	45,573,330 - 45,608,796 (+)	Ensembl
mRatBN7.2 Ensembl	19	28,669,059 - 28,704,508 (+)	Ensembl
Rnor_6.0 Ensembl	19	32,344,078 - 32,380,025 (+)	Ensembl

RefSeq Acc Id:

NM_001025764 ⟹ NP_001020935

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	45,573,330 - 45,608,796 (+)	NCBI
mRatBN7.2	19	28,669,044 - 28,704,512 (+)	NCBI
Rnor_6.0	19	32,344,078 - 32,380,029 (+)	NCBI
Rnor_5.0	19	43,240,203 - 43,275,432 (+)	NCBI
RGSC_v3.4	19	30,505,305 - 30,540,608 (+)	RGD
Celera	19	28,177,863 - 28,212,691 (+)	RGD

Sequence:

show sequence

CTAGAAGGGAATGAACTCTTCGCCCTGCCCAGGGCTTGAACCGCTGTTGCCTACAGCTTCCCTG
TCCGCCCATAGCCATGTCGCACTTCTTGTACTTAGCCCCGGAAATCCAGCTTCCCTTTAGCCCT
CTCACTTCTACAGAGTTCGAGCTGATCAGACGCAAGGCCCGAGAACTGTGGCAGAATGAGGCGC
GATGGTCTACTTCTTCAGTGACAACCTACTCAGGGAGTTACCGGGAAAAGCAACTGGATGAGGC
CTCCTGCCACCGGCTGGCCCAGAGATTTGGCCAGCCTCACTTTGAATACAAACCAGCACCATTG
CCAGGCGGCTCTGCCTACAACGCTCTACCCGGCCAGGCTGGTTCCCAGGAGGCTGCAGATGGCA
AAGGCAGACTCCCTGATATAACAAGCCCCTCCCAGGACAGCACACTGAACATCAAGCACAAAGT
GGCACATCAGAGTTGGAGTTCTGGAACCTCTCGTCCAACATGTCTAGCTTATAGACCACGCCAC
CTGTCCCCCAGTTCAAAGCCCAAAAGGCCAGGCTTTGAGCTCCTCATGAGTTACAGGAACAGAG
GGAGGAAACTACTGAGACAACTTCAGCGACAATGGGATTATGAAAACAAGTTAGGCTCCTCAGA
TGATTCAGACACGGATCGATTCTCCTCCGTTACCAGTGGAAGCTCCAGGCGGAAATTCAAGTAA
TTTCGAGAAAGAAGTCACAAACCGAGGGCCCTAACTTCTGTGTTAACCCATTGAGACAGGAGTT
CCAAGGAGGCCTTGGTATGGTATGCACATAGGGAACACCTTGCTTCAAACTTCCCCGGGCTTCA
TCCCTCCTTGTGTCTCTGTGCGCTGTGCATGTGCGTGGCGTGTACGTTGATGGGGAAGGGAATT
TGTCACAAACATGATTAATGTTCCTTTACAATAAGTGCCCAGGCTCACATTCTGCTGTAAGAAC
CTCACAAATTACGGTGGGCTCCAGAGTTATACAGCCTGTCCTTTACCCCAGAGAAAGACTTTTC
TGTTTCTCCCTGAGCTATGGCCCAGAATAGAAAGCCCTCCTCAGCAGGCAGGGTTTCCCTCCAC
TCAGGGAAAACTGGCTTCGCTGGCGGCTCCTCCTCCCATGGACCTGCGCCTCCTTCTTCCCACT
GTGTCTGCCCCAGCGGGGTCCCCACGCGGCCCTGTGGTTGCCCTGCCGGAAAGCCGCCAAGGGA
CCTGGCAGAGAAGGAGCAAGCTACGGAATAATAGTGCCCTTCTCCTGCTGGCAGTCATTCCTCT
GCCACCCGGAGCTTCGGTGCCCCTGATCCAGCCTGTACCCCAACCCACGGCTCCCCTTGAACAG
AGTACAAAAGTCGCACCCTAGTCCCCTAGCCGCCCCCTCCCCCCACGACCCAGCACTTAACTAT
GTTTTTCCGTTAGCTCCAGGTTGGGCTAAATACATTCGCTGGGAGCCATCTGGTCTGCTTCCCG
GGAACTCTTCATGTGGTTTCCATTAAAGTCGCCAGAATCATGCATTGAAAAAAAAAAAAAAAAA
AAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063278188 ⟹ XP_063134258

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	45,573,267 - 45,605,186 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001020935	(Get FASTA)	NCBI Sequence Viewer
	XP_063134258	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH98038	(Get FASTA)	NCBI Sequence Viewer
	EDL92315	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000015541
	ENSRNOP00000015541.4
GenBank Protein	Q4V7B2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001020935 ⟸ NM_001025764

- UniProtKB:

Q4V7B2 (UniProtKB/Swiss-Prot), A6IYI7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSHFLYLAPEIQLPFSPLTSTEFELIRRKARELWQNEARWSTSSVTTYSGSYREKQLDEASCHR
LAQRFGQPHFEYKPAPLPGGSAYNALPGQAGSQEAADGKGRLPDITSPSQDSTLNIKHKVAHQS
WSSGTSRPTCLAYRPRHLSPSSKPKRPGFELLMSYRNRGRKLLRQLQRQWDYENKLGSSDDSDT
DRFSSVTSGSSRRKFK

hide sequence

Ensembl Acc Id:

ENSRNOP00000015541 ⟸ ENSRNOT00000015541

RefSeq Acc Id:	XP_063134258 ⟸ XM_063278188
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4V7B2-F1-model_v2	AlphaFold	Q4V7B2	1-208	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701053

Promoter ID:

EPDNEW_R11576

Type:

initiation region

Name:

LOC498933_1

Description:

LOC498933

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	19	32,344,063 - 32,344,123	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1561806	AgrOrtholog
BioCyc Gene	G2FUF-5944	BioCyc
Ensembl Genes	ENSRNOG00000011671	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000015541	ENTREZGENE
	ENSRNOT00000015541.5	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7456623	IMAGE-MGC_LOAD
InterPro	DUF4722	UniProtKB/Swiss-Prot
KEGG Report	rno:498933	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:116194	IMAGE-MGC_LOAD
NCBI Gene	498933	ENTREZGENE
Pfam	DUF4722	UniProtKB/Swiss-Prot
PhenoGen	C19h4orf51	PhenoGen
RatGTEx	ENSRNOG00000011671	RatGTEx
UniProt	A6IYI7	ENTREZGENE, UniProtKB/TrEMBL
	CD051_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2023-09-19	C19h4orf51	similar to human chromosome 4 open reading frame 51	LOC498933	LOC498933	Symbol and Name Changed	1299863	APPROVED
2006-02-09	LOC498933	LOC498933			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message