Advanced Search (OLGA)

Gene: Rergl (RERG like) Rattus norvegicus

Analyze

Symbol:

Rergl

Name:

RERG like

RGD ID:

1560090

Description:

Predicted to enable GTP binding activity and GTPase activity. Orthologous to human RERGL (RERG like); INTERACTS WITH bisphenol A; aflatoxin B1 (ortholog); cannabidiol (ortholog).

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC500356; ras-related and estrogen-regulated growth inhibitor-like protein; RERG/RAS-like; RGD1560090; similar to hypothetical protein FLJ22655

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RERGL (RERG like)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Rergl (RERG/RAS-like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rergl (RERG like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RERGL (RERG like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RERGL (RERG like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rergl (RERG like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RERGL (RERG like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RERGL (RERG like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rergl (RERG like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Rergl (RERG like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	RERGL (RERG like)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rergl (RERG/RAS-like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rergla (RERG/RAS-like a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG8519	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG8519	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	XB5824245 [provisional:rergl]	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	XB5824245 [provisional:rergl]	Alliance	DIOPT (OrthoFinder\|OrthoInspector)
Xenopus tropicalis (tropical clawed frog):	rergl	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rergl	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	174,114,882 - 174,123,972 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	174,114,882 - 174,124,080 (-)	Ensembl				GRCr8
mRatBN7.2	4	172,383,688 - 172,392,778 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	172,383,688 - 172,392,778 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	178,678,680 - 178,687,774 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	174,462,828 - 174,471,922 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	173,083,354 - 173,092,448 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	173,631,056 - 173,640,757 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	173,631,052 - 173,640,684 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	237,872,435 - 237,881,842 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	176,611,617 - 176,620,707 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	160,942,643 - 160,951,734 (-)	NCBI		Celera
Cytogenetic Map	4	q44	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

prostate cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

aflatoxin B1 (ISO)

bisphenol A (EXP,ISO)

cannabidiol (ISO)

Cuprizon (ISO)

nickel atom (ISO)

silicon dioxide (ISO)

titanium dioxide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Molecular Function

G protein activity (IEA)

GTP binding (IEA)

GTPase activity (IEA)

hydrolase activity (IEA)

nucleotide binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	GOA pipeline	RGD automated data pipeline
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Rergl
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	174,114,882 - 174,123,972 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	174,114,882 - 174,124,080 (-)	Ensembl				GRCr8
mRatBN7.2	4	172,383,688 - 172,392,778 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	172,383,688 - 172,392,778 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	178,678,680 - 178,687,774 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	174,462,828 - 174,471,922 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	173,083,354 - 173,092,448 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	173,631,056 - 173,640,757 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	173,631,052 - 173,640,684 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	237,872,435 - 237,881,842 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	176,611,617 - 176,620,707 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	160,942,643 - 160,951,734 (-)	NCBI		Celera
Cytogenetic Map	4	q44	NCBI

RERGL
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	18,080,869 - 18,090,193 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	18,080,869 - 18,320,107 (-)	Ensembl			hg38	GRCh38
GRCh37	12	18,233,803 - 18,243,127 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	18,125,070 - 18,134,381 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	12	23,379,334 - 23,388,645 (-)	NCBI		Celera
Cytogenetic Map	12	p12.3	NCBI
HuRef	12	18,002,531 - 18,011,842 (-)	NCBI		HuRef
CHM1_1	12	18,198,989 - 18,208,291 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	17,957,086 - 17,966,409 (-)	NCBI		T2T-CHM13v2.0

Rergl
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	139,470,180 - 139,478,907 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	139,469,971 - 139,478,974 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	139,493,182 - 139,501,909 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	139,492,973 - 139,501,976 (-)	Ensembl			mm10	GRCm38
MGSCv37	6	139,441,703 - 139,450,430 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	139,457,410 - 139,466,070 (-)	NCBI		MGSCv36	mm8
Celera	6	142,574,945 - 142,583,659 (-)	NCBI		Celera
Cytogenetic Map	6	G2	NCBI
cM Map	6	69.67	NCBI

Rergl
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	14,324,103 - 14,335,033 (-)	Ensembl
ChiLan1.0	NW_004955413	14,324,734 - 14,334,992 (-)	NCBI	ChiLan1.0	ChiLan1.0

RERGL
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	23,515,155 - 23,524,478 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	23,511,915 - 23,521,238 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	18,071,002 - 18,080,326 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	18,456,879 - 18,466,202 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	18,456,879 - 18,466,282 (-)	Ensembl			panPan2	panpan1.1

RERGL
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	28,943,933 - 28,959,374 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	27	28,943,650 - 28,953,669 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	17,492,972 - 17,508,296 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	29,274,741 - 29,290,059 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	27	29,274,447 - 29,286,958 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	27	29,107,947 - 29,123,241 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	29,107,730 - 29,123,067 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	17,205,355 - 17,220,882 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Rergl
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	90,126,893 - 90,136,191 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936548	8,049,789 - 8,058,472 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936548	8,049,789 - 8,058,472 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RERGL
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	54,939,887 - 54,955,629 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	5	54,939,384 - 54,952,059 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	58,236,162 - 58,249,720 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RERGL
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	17,928,575 - 17,938,408 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	17,928,557 - 17,938,351 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666069	17,278,628 - 17,288,443 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rergl
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624752	20,348,663 - 20,357,193 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624752	20,348,777 - 20,356,858 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Rergl
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	10,012,842 - 10,021,885 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Rergl
77 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	165
Count of miRNA genes:	108
Interacting mature miRNAs:	122
Transcripts:	ENSRNOT00000010728
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
6478754	Anxrr43	Anxiety related response QTL 43		0.14035	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	146370897	184426481	Rat
724558	Plsm2	Polydactyly-luxate syndrome (PLS) morphotypes QTL 2		0.0003	hindlimb integrity trait (VT:0010563)	hind foot phalanges count (CMO:0001949)	4	134095016	179095016	Rat
6478693	Anxrr32	Anxiety related response QTL 32		0.00092	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	146370897	184426481	Rat
6478757	Anxrr44	Anxiety related response QTL 44		0.01087	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
1358364	Sradr4	Stress Responsive Adrenal Weight QTL 4	4.92		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	131384565	176384565	Rat
1331738	Bp209	Blood pressure QTL 209	2.979		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	140059299	181024663	Rat
6478700	Anxrr33	Anxiety related response QTL 33		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
1298524	Oia8	Oil induced arthritis QTL 8			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	140059299	184426481	Rat
10053718	Scort25	Serum corticosterone level QTL 25	2.15	0.0097	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	157292416	184426481	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	60916264	184426481	Rat
10401796	Kidm48	Kidney mass QTL 48			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	147299608	184426481	Rat
6478718	Anxrr34	Anxiety related response QTL 34		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
6478782	Anxrr52	Anxiety related response QTL 52		0.02091	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
6478720	Alc23	Alcohol consumption QTL 23		0.00509	drinking behavior trait (VT:0001422)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	155834926	184426481	Rat
6478785	Anxrr53	Anxiety related response QTL 53		0.01397	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	100752691	179366077	Rat
1581566	Eae21	Experimental allergic encephalomyelitis QTL 21	6.2		body mass (VT:0001259)	maximum body weight loss to initial body weight ratio (CMO:0001400)	4	137447185	182447185	Rat
1578674	Bmd12	Bone mineral density QTL 12	3.8		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	4	137430611	182430611	Rat
6478728	Anxrr36	Anxiety related response QTL 36		0.01061	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	184426481	Rat
634342	Cia24	Collagen induced arthritis QTL 24	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	148121375	176967367	Rat
6478733	Anxrr37	Anxiety related response QTL 37		0.00095	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
61362	Oia2	Oil induced arthritis QTL 2		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	140059299	184426481	Rat
6478737	Anxrr38	Anxiety related response QTL 38		0.00159	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
2293659	Bmd35	Bone mineral density QTL 35	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	4	160623982	184426481	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat
6478748	Anxrr42	Anxiety related response QTL 42		0.28008	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system
8	11	55	92	45	42	15	25	15	6	213	111	8	64	71	87	27

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001191979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008763418	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473964	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010728 ⟹ ENSRNOP00000010728

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	174,114,882 - 174,123,972 (-)	Ensembl
mRatBN7.2 Ensembl	4	172,383,688 - 172,392,778 (-)	Ensembl
Rnor_6.0 Ensembl	4	173,631,052 - 173,640,684 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000130920 ⟹ ENSRNOP00000111569

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	174,114,882 - 174,124,080 (-)	Ensembl

RefSeq Acc Id:

NM_001191979 ⟹ NP_001178908

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	174,114,882 - 174,123,972 (-)	NCBI
mRatBN7.2	4	172,383,688 - 172,392,778 (-)	NCBI
Rnor_6.0	4	173,631,295 - 173,640,702 (-)	NCBI
Rnor_5.0	4	237,872,435 - 237,881,842 (-)	NCBI
Celera	4	160,942,643 - 160,951,734 (-)	NCBI

Sequence:

show sequence

TGGTCTGCAGGGTTCCAAAACCAAATGAGCTACTCAAGATGGGTGATGTCAAGCTTGCTGTCTT
GGGTGGCAGAGGTACAGGAAAATCAGCTCTTACAGTAAGGTTTCTTACCAAGCGCTTCATTGGG
GAATACGCTTCTAATTTTGAATCTATCTATAATAAACACTTGTGTTTGGAAGGAAAACCATTAA
ATCTGGAAATATATGACCCATGTTCTCAATCACAGAAAGCAAAAGGCTCCCTCACAAGTGACCT
GCACTGGGCAGATGGGTTTGTGATTGTGTACGACATCAGCAACAGGCCTTCCTTTGCTTTTGCA
AAAGCCCTTATCTACAGAATCCGTGAGCCACCAATGACTCATTGTAAAAGGGTCATGGAACCAG
CTGTGGTTTTAGTTGGCAACAAGCAAGACCTCTGCCACATGAGAGAGGTTGGCTGGGATGAAGG
GCAAAAGCTAGCAACCGATTACCGCTGCCAATTCTGTGAGCTGTCGGCAGCAGAGCAGTCCCTG
GAGATTGAGGTGATGTTTCTCAGACTCATCAAAGACATTCTGATGATCTTCAAACATAAGGAGA
AGAGAAGACCCAGTGGGTCGAAATCAATGGCCAAACTAATCAATAATGTATTTGGAAAGAGGAG
GAAATCTGTTTAATAGACATATGATCCAGTGGAATTGATCCATCAAAGAATTTCAGACACTTAA
ATGGCAACTACAGCTATGACTTATACAATTACATTTACAATTTATACAATTACACTTAAAATTT
TTACAATTAAAATGCAGAATTTTTTGAGACATGAAATGACTAAAAAGTCAGTCATTGTTTTATC
TTAAAATATATAATTCATTCTTTGAGTTATATTTGGTTACCATTGTTTCTTACACACAAAATTT
CACTTGTATGAGCAAATACTCATTCTTGTGTAAAAGTGGAAAGCTATCCCCTAAGCCTCATTTA
GAAAACTCTGCACATGTTG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001178908	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM01566	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010728
	ENSRNOP00000010728.5
	ENSRNOP00000111569.1

RefSeq Acc Id:

NP_001178908 ⟸ NM_001191979

- UniProtKB:

D3ZM99 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGDVKLAVLGGRGTGKSALTVRFLTKRFIGEYASNFESIYNKHLCLEGKPLNLEIYDPCSQSQK
AKGSLTSDLHWADGFVIVYDISNRPSFAFAKALIYRIREPPMTHCKRVMEPAVVLVGNKQDLCH
MREVGWDEGQKLATDYRCQFCELSAAEQSLEIEVMFLRLIKDILMIFKHKEKRRPSGSKSMAKL
INNVFGKRRKSV

hide sequence

Ensembl Acc Id:

ENSRNOP00000010728 ⟸ ENSRNOT00000010728

Ensembl Acc Id:

ENSRNOP00000111569 ⟸ ENSRNOT00000130920

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZM99-F1-model_v2	AlphaFold	D3ZM99	1-204	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1560090	AgrOrtholog
BioCyc Gene	G2FUF-42550	BioCyc
Ensembl Genes	ENSRNOG00000008130	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000010728	ENTREZGENE
	ENSRNOT00000010728.9	UniProtKB/TrEMBL
	ENSRNOT00000130920.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.300	UniProtKB/TrEMBL
InterPro	P-loop_NTPase	UniProtKB/TrEMBL
	Ras-related_GTPase	UniProtKB/TrEMBL
	Ras_GTPase	UniProtKB/TrEMBL
KEGG Report	rno:500356	UniProtKB/TrEMBL
NCBI Gene	500356	ENTREZGENE
PANTHER	RAS-LIKE FAMILY MEMBER 11	UniProtKB/TrEMBL
Pfam	Ras	UniProtKB/TrEMBL
PhenoGen	Rergl	PhenoGen
PRINTS	RASTRNSFRMNG	UniProtKB/TrEMBL
PROSITE	RAB	UniProtKB/TrEMBL
	RAS	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000008130	RatGTEx
SMART	RAB	UniProtKB/TrEMBL
	RAS	UniProtKB/TrEMBL
Superfamily-SCOP	SSF52540	UniProtKB/TrEMBL
UniProt	A0ABK0M7Q3_RAT	UniProtKB/TrEMBL
	D3ZM99	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-16	Rergl	RERG like	Rergl	RERG/RAS-like	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-05-02	Rergl	RERG/RAS-like	RGD1560090	similar to hypothetical protein FLJ22655	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1560090	similar to hypothetical protein FLJ22655	RGD1560090_predicted	similar to hypothetical protein FLJ22655 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1560090_predicted	similar to hypothetical protein FLJ22655 (predicted)	LOC500356	similar to hypothetical protein FLJ22655	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC500356	similar to hypothetical protein FLJ22655			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar