Advanced Search (OLGA)

Gene: Sypl1 (synaptophysin-like 1) Rattus norvegicus

Analyze

Symbol:

Sypl1

Name:

synaptophysin-like 1

RGD ID:

1359569

Description:

Is active in synaptic vesicle membrane. Orthologous to human SYPL1 (synaptophysin like 1); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; acetamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

DNA segment, Chr 12, ERATO Doi 446, expressed; LOC366595; Pan I; pantophysin; similar to synaptophysin-like protein; synaptophysin-like protein; synaptophysin-like protein 1; Sypl

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SYPL1 (synaptophysin like 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Sypl1 (synaptophysin like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Sypl1 (synaptophysin like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SYPL1 (synaptophysin like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SYPL1 (synaptophysin like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Sypl1 (synaptophysin like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SYPL1 (synaptophysin like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SYPL1 (synaptophysin like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Sypl1 (synaptophysin like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Sypl1 (synaptophysin like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	LAT (linker for activation of T cells)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	SYPL1 (synaptophysin like 1)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Sypl1 (synaptophysin like 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Sypl1 (synaptophysin like 1)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	sypl2b (synaptophysin-like 2b)	Alliance	DIOPT (Hieranoid\|OMA\|OrthoInspector\|PANTHER)
Danio rerio (zebrafish):	sypl2b (synaptophysin-like 2b)	Alliance	DIOPT (Hieranoid\|OMA\|PANTHER)
Danio rerio (zebrafish):	sypl1 (synaptophysin-like 1)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	sypl2a (synaptophysin-like 2a)	Alliance	DIOPT (Hieranoid\|OMA\|OrthoInspector\|PANTHER)
Danio rerio (zebrafish):	sypl2a (synaptophysin-like 2a)	Alliance	DIOPT (Hieranoid\|OMA\|PANTHER)
Caenorhabditis elegans (roundworm):	sph-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	sph-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	sypl1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	sypl1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	55,292,555 - 55,311,519 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	55,292,567 - 55,314,714 (+)	Ensembl				GRCr8
mRatBN7.2	6	49,565,111 - 49,585,205 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	49,565,154 - 49,585,330 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	49,867,721 - 49,886,582 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	50,182,641 - 50,201,502 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	49,619,516 - 49,638,454 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	52,265,920 - 52,286,037 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	52,265,930 - 52,285,029 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	61,891,950 - 61,912,044 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	51,284,538 - 51,303,975 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	48,757,109 - 48,776,040 (+)	NCBI		Celera
RGSC_v3.1	6	51,287,663 - 51,307,100 (+)	NCBI
Cytogenetic Map	6	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

intellectual disability (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dimethoxyphenol (ISO)

acetamide (EXP)

actinomycin D (ISO)

all-trans-retinoic acid (ISO)

alpha-Solamarine (ISO)

amphetamine (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bromobenzene (EXP)

Butylbenzyl phthalate (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

chromium(6+) (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

deguelin (ISO)

Dibutyl phosphate (ISO)

dicrotophos (ISO)

disodium selenite (ISO)

folic acid (ISO)

furfural (ISO)

gallic acid (ISO)

gentamycin (EXP)

haloperidol (ISO)

ivermectin (ISO)

lead(0) (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methyl methanesulfonate (ISO)

nitrates (ISO)

Nutlin-3 (ISO)

olanzapine (ISO)

phenobarbital (ISO)

phenytoin (EXP)

picoxystrobin (ISO)

rotenone (ISO)

sevoflurane (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium chloride (ISO)

testosterone (ISO)

thiram (ISO)

titanium dioxide (ISO)

trimellitic anhydride (ISO)

triptonide (ISO)

tunicamycin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

membrane (IEA,ISO)

secretory granule (ISO)

synaptic vesicle (IEA)

synaptic vesicle membrane (EXP,IDA)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Pantophysin is a ubiquitously expressed synaptophysin homologue and defines constitutive transport vesicles.	Haass NK, etal., J Cell Biol 1996 Aug;134(3):731-46.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
7.	Molecular anatomy of a trafficking organelle.	Takamori S, etal., Cell. 2006 Nov 17;127(4):831-46.

Additional References at PubMed

PMID:19056867	PMID:23376485

Genomics

Comparative Map Data

Sypl1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	55,292,555 - 55,311,519 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	55,292,567 - 55,314,714 (+)	Ensembl				GRCr8
mRatBN7.2	6	49,565,111 - 49,585,205 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	49,565,154 - 49,585,330 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	49,867,721 - 49,886,582 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	50,182,641 - 50,201,502 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	49,619,516 - 49,638,454 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	52,265,920 - 52,286,037 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	52,265,930 - 52,285,029 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	61,891,950 - 61,912,044 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	51,284,538 - 51,303,975 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	48,757,109 - 48,776,040 (+)	NCBI		Celera
RGSC_v3.1	6	51,287,663 - 51,307,100 (+)	NCBI
Cytogenetic Map	6	q16	NCBI

SYPL1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	106,090,505 - 106,112,576 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	106,090,500 - 106,112,589 (-)	Ensembl			hg38	GRCh38
GRCh37	7	105,730,951 - 105,753,022 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	105,518,187 - 105,540,293 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	7	105,324,904 - 105,346,709	NCBI
Celera	7	100,536,483 - 100,558,573 (-)	NCBI		Celera
Cytogenetic Map	7	q22.3	NCBI
HuRef	7	100,090,269 - 100,112,533 (-)	NCBI		HuRef
CHM1_1	7	105,664,455 - 105,686,718 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	107,405,910 - 107,427,970 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	105,091,838 - 105,114,101 (-)	NCBI

Sypl1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	33,003,874 - 33,029,503 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	33,003,890 - 33,029,859 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	12	32,953,855 - 32,979,502 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	32,953,891 - 32,979,860 (+)	Ensembl			mm10	GRCm38
MGSCv37	12	33,638,810 - 33,664,367 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	12	33,539,215 - 33,562,151 (+)	NCBI		MGSCv36	mm8
Celera	12	34,399,839 - 34,425,394 (+)	NCBI		Celera
Cytogenetic Map	12	A3	NCBI
cM Map	12	13.87	NCBI

Sypl1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955410	10,568,594 - 10,591,040 (-)	Ensembl
ChiLan1.0	NW_004955410	10,571,888 - 10,590,978 (-)	NCBI	ChiLan1.0	ChiLan1.0

SYPL1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	142,935,536 - 142,957,769 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	191,205,504 - 191,227,737 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	98,074,940 - 98,097,052 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	110,802,971 - 110,824,694 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	110,802,978 - 110,824,735 (-)	Ensembl			panPan2	panpan1.1

SYPL1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	14,356,655 - 14,380,755 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	14,371,040 - 14,379,546 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	14,004,632 - 14,029,843 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	14,630,874 - 14,656,058 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	14,630,410 - 14,656,044 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	14,442,399 - 14,467,548 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	14,364,040 - 14,389,296 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	14,644,518 - 14,669,676 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Sypl1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	56,709,824 - 56,730,539 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936479	17,832,329 - 17,854,659 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936479	17,833,605 - 17,853,018 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SYPL1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	105,918,115 - 105,986,107 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	9	105,952,898 - 105,985,172 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	116,645,475 - 116,678,121 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SYPL1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	75,005,164 - 75,024,521 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	75,003,465 - 75,024,758 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666042	28,886,351 - 28,905,937 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sypl1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624739	23,564,981 - 23,585,379 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624739	23,564,941 - 23,585,379 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Sypl1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	7	46,302,182 - 46,322,297 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Sypl1
80 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	113
Count of miRNA genes:	94
Interacting mature miRNAs:	104
Transcripts:	ENSRNOT00000067849
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9590290	Uminl2	Urine mineral level QTL 2	3.96	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	6	44510974	89510974	Rat
8693632	Alc27	Alcohol consumption QTL 27	2.2	0.791	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	6	40052411	56848866	Rat
634318	Bw118	Body weight QTL 118	3.55		abdominal fat pad mass (VT:1000711)	abdominal fat pad weight (CMO:0000088)	6	39028659	63457441	Rat
4889933	Bss88	Bone structure and strength QTL 88	3.8		tibia size trait (VT:0100001)	tibia total bone volume (CMO:0001724)	6	53684921	98684921	Rat
634307	Bp141	Blood pressure QTL 141	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	40957564	85957564	Rat
10401812	Kidm54	Kidney mass QTL 54			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	6	20097635	65097635	Rat
1331743	Uae28	Urinary albumin excretion QTL 28	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	45153786	90153786	Rat
8552910	Pigfal5	Plasma insulin-like growth factor 1 level QTL 5	4.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	6	22653889	67653889	Rat
5684992	Bmd83	Bone mineral density QTL 82	4.8		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	6	53684921	98684921	Rat
10401800	Kidm49	Kidney mass QTL 49			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	6	20097635	65097635	Rat
1331779	Rf38	Renal function QTL 38	2.876		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	31185002	76185002	Rat
737827	Hcar11	Hepatocarcinoma resistance QTL 11	4.4		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	6	46050607	116278722	Rat
724513	Uae14	Urinary albumin excretion QTL 14	6.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	46047353	91047353	Rat
2293839	Kiddil2	Kidney dilation QTL 2	4.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	26618314	86868070	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	20859430	113082285	Rat
9590140	Scort4	Serum corticosterone level QTL 4	14.49	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	44510974	89510974	Rat
2301964	Bp323	Blood pressure QTL 323	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	1	86868070	Rat
9590306	Scort18	Serum corticosterone level QTL 18	2.88	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	44510974	89510974	Rat
1578665	Bss16	Bone structure and strength QTL 16	4.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	6	33328841	78328841	Rat
2293841	Kiddil4	Kidney dilation QTL 4	4.4		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	26618314	86868070	Rat
1641898	Colcr4	Colorectal carcinoma resistance QTL4	3.71	0.0007	intestine integrity trait (VT:0010554)	well differentiated malignant colorectal tumor surface area measurement (CMO:0002077)	6	30937632	75937632	Rat
1578668	Bmd14	Bone mineral density QTL 14	3.8		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	6	33328841	78328841	Rat
6893340	Cm77	Cardiac mass QTL 77	0.26	0.57	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	39028659	86867923	Rat
5684963	Bss99	Bone structure and strength QTL 99	3.1		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	6	53684921	98684921	Rat
70199	Coreg1	Compensatory renal growth QTL 1	11.8		kidney mass (VT:0002707)	compensatory renal growth score (CMO:0001894)	6	14599473	63457687	Rat
2301972	Bp325	Blood pressure QTL 325	4.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	16089372	61967788	Rat
1300143	Rf14	Renal function QTL 14	2.92		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	40163183	85163183	Rat
1354664	Slep2	Serum leptin concentration QTL 2	4.49		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	6	22288257	67288257	Rat

Markers in Region

RH130183

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	49,582,406 - 49,583,949 (+)	MAPPER	mRatBN7.2
mRatBN7.2	6	49,582,457 - 49,583,949 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	52,283,192 - 52,284,794	NCBI	Rnor6.0
Rnor_6.0	6	52,283,303 - 52,284,794	NCBI	Rnor6.0
Rnor_5.0	6	61,909,310 - 61,910,801	UniSTS	Rnor5.0
Rnor_5.0	6	61,909,199 - 61,910,801	UniSTS	Rnor5.0
RGSC_v3.4	6	51,302,344 - 51,303,835	UniSTS	RGSC3.4
Celera	6	48,774,409 - 48,775,900	UniSTS
Cytogenetic Map	6	q16	UniSTS

RH144304

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	49,571,098 - 49,571,342 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	52,271,834 - 52,272,077	NCBI	Rnor6.0
Rnor_5.0	6	61,897,841 - 61,898,084	UniSTS	Rnor5.0
RGSC_v3.4	6	51,290,850 - 51,291,093	UniSTS	RGSC3.4
Celera	6	48,763,055 - 48,763,298	UniSTS
RH 3.4 Map	6	321.3	UniSTS
Cytogenetic Map	6	q16	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001014263	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006240001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017594250	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039112628	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_001838189	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC082078	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000067849 ⟹ ENSRNOP00000063771

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	49,565,154 - 49,584,088 (+)	Ensembl
Rnor_6.0 Ensembl	6	52,265,957 - 52,284,933 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000087513 ⟹ ENSRNOP00000075299

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	49,565,686 - 49,585,209 (+)	Ensembl
Rnor_6.0 Ensembl	6	52,265,930 - 52,285,029 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097655 ⟹ ENSRNOP00000090114

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	55,292,567 - 55,312,590 (+)	Ensembl
mRatBN7.2 Ensembl	6	49,565,562 - 49,585,016 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108721 ⟹ ENSRNOP00000088430

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	55,292,891 - 55,312,590 (+)	Ensembl
mRatBN7.2 Ensembl	6	49,565,487 - 49,585,330 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000142277 ⟹ ENSRNOP00000102106

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	55,292,986 - 55,314,714 (+)	Ensembl

RefSeq Acc Id:

NM_001014263 ⟹ NP_001014285

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	55,292,577 - 55,311,514 (+)	NCBI
mRatBN7.2	6	49,565,154 - 49,584,089 (+)	NCBI
Rnor_6.0	6	52,265,957 - 52,284,934 (+)	NCBI
Rnor_5.0	6	61,891,950 - 61,912,044 (+)	NCBI
RGSC_v3.4	6	51,284,538 - 51,303,975 (+)	RGD
Celera	6	48,757,109 - 48,776,040 (+)	RGD

Sequence:

show sequence

CTAGGGAGCGCGCGTGCGCTGTAGAGAAAGAGATAGGCTTTGGGGAAAGGGGCGCCACACGCAT
GGCTTCCAAAGCCTACTTGATTCGCCAGCGGTTCAGCCGGCTGAGTCAGAGGATGTCCACCTTC
CAGATCAACCTCAACCCGCTCAAGGAGCCGCTCGGCTTCATCAAGATCCTCGAGTGGTTTGCTT
CTATCTTTGCTTTTGCCACCTGTGGTGGGTTTAAGGGCAAAACAGAAATTCAAGTGAATTGTCT
TTCTGCACCTGGTGAAAATAAGACGATTACAGCTACTTTTGGTTATCCATTCAGGTTGAATCAG
GCATCATTTCATTCAGCTCCAAATGTCAATGTGTGTAAGGTGAATTGGGAAAAGCATGTCCTCA
TAGGTGATTACTCCTCTTCCGCACAGTTCTATGTCACCTTTGCAGTCTTGGTGTTCCTGTACTG
CATTGCTGCCCTTCTCCTCTATGTTGGTTACACCAACCTCTACCGGGATAGTCGCAAACTGCCC
ATGATCGACTTTATTGTTACTCTTGTTGCTACTTTTTTGTGGTTGGTGAGTTCCTCGGCCTGGG
CTAAAGCTCTTACAGATATTAAGGTAGCTACTGGACACAGAATTGTTGAAGAACTTGATCCTTG
TAAGTCAGAAGTGTCATGTTACTTTGTCTCTGTGACTAGTATGGGGTCCCTGAATGTATCCGTG
ATCTTTGGCTTTCTGAATATGATACTTTGGGGAGGAAATGCTTGGTTTGTGTACAAGGAGACCA
GCTTACATAGTCCATCAAATACGTCAGCTTCTCATGGCCAAGGAGGTGTCCCACCCACTTCTGG
AATGTAATTAAAGGGAGAAATACACTGTATGAAATGTGTGCTATACTATGCCTTGTTGCCAACA
TCTTGAGAAGCATTATTGTTTCTAATAAAAAGTAATGGCTTTTTCAAAAAAAAAAAAAAAAAAA
AAAAA

hide sequence

RefSeq Acc Id:

XM_039112628 ⟹ XP_038968556

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	55,292,555 - 55,311,519 (+)	NCBI
mRatBN7.2	6	49,565,112 - 49,585,205 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001014285	(Get FASTA)	NCBI Sequence Viewer
	XP_038968556	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH82078	(Get FASTA)	NCBI Sequence Viewer
	EDM03276	(Get FASTA)	NCBI Sequence Viewer
	EDM03277	(Get FASTA)	NCBI Sequence Viewer
	EDM03278	(Get FASTA)	NCBI Sequence Viewer
	EDM03279	(Get FASTA)	NCBI Sequence Viewer
	EDM03280	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000088430
	ENSRNOP00000088430.2
	ENSRNOP00000090114.2
	ENSRNOP00000102106.1

RefSeq Acc Id:

NP_001014285 ⟸ NM_001014263

- UniProtKB:

Q66H18 (UniProtKB/TrEMBL), D3ZZU5 (UniProtKB/TrEMBL), A0A9K3Y7R4 (UniProtKB/TrEMBL), A6HB73 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASKAYLIRQRFSRLSQRMSTFQINLNPLKEPLGFIKILEWFASIFAFATCGGFKGKTEIQVNC
LSAPGENKTITATFGYPFRLNQASFHSAPNVNVCKVNWEKHVLIGDYSSSAQFYVTFAVLVFLY
CIAALLLYVGYTNLYRDSRKLPMIDFIVTLVATFLWLVSSSAWAKALTDIKVATGHRIVEELDP
CKSEVSCYFVSVTSMGSLNVSVIFGFLNMILWGGNAWFVYKETSLHSPSNTSASHGQGGVPPTS
GM

hide sequence

Ensembl Acc Id:

ENSRNOP00000063771 ⟸ ENSRNOT00000067849

Ensembl Acc Id:

ENSRNOP00000075299 ⟸ ENSRNOT00000087513

RefSeq Acc Id:	XP_038968556 ⟸ XM_039112628
- Peptide Label:	isoform X1
- UniProtKB:	A6HB74 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000090114 ⟸ ENSRNOT00000097655

Ensembl Acc Id:

ENSRNOP00000088430 ⟸ ENSRNOT00000108721

Ensembl Acc Id:

ENSRNOP00000102106 ⟸ ENSRNOT00000142277

Protein Domains

MARVEL

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2KA82-F1-model_v2	AlphaFold	A0A0G2KA82	1-295	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694549

Promoter ID:

EPDNEW_R5074

Type:

initiation region

Name:

Sypl1_1

Description:

synaptophysin-like 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	52,265,919 - 52,265,979	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359569	AgrOrtholog
BioCyc Gene	G2FUF-37874	BioCyc
Ensembl Genes	ENSRNOG00000009856	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000097655.2	UniProtKB/TrEMBL
	ENSRNOT00000108721	ENTREZGENE
	ENSRNOT00000108721.2	UniProtKB/TrEMBL
	ENSRNOT00000142277.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7133263	IMAGE-MGC_LOAD
InterPro	Marvel	UniProtKB/TrEMBL
	Synaptophysin/porin	UniProtKB/TrEMBL
KEGG Report	rno:366595	UniProtKB/TrEMBL
MGC_CLONE	MGC:95246	IMAGE-MGC_LOAD
NCBI Gene	366595	ENTREZGENE
PANTHER	Synaptophysin	UniProtKB/TrEMBL
	SYNAPTOPHYSIN-LIKE PROTEIN 1	UniProtKB/TrEMBL
Pfam	MARVEL	UniProtKB/TrEMBL
PhenoGen	Sypl1	PhenoGen
PRINTS	SYNAPTOPHYSN	UniProtKB/TrEMBL
PROSITE	MARVEL	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000009856	RatGTEx
UniProt	A0A8I6A9E4_RAT	UniProtKB/TrEMBL
	A0A8I6A9F2_RAT	UniProtKB/TrEMBL
	A0A9K3Y7R4	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LBF5_RAT	UniProtKB/TrEMBL
	A6HB73	ENTREZGENE, UniProtKB/TrEMBL
	A6HB74	ENTREZGENE, UniProtKB/TrEMBL
	D3ZZU5	ENTREZGENE
	Q66H18	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-10-23	Sypl1	synaptophysin-like 1	Sypl	synaptophysin-like protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Sypl	synaptophysin-like protein	LOC366595	similar to synaptophysin-like protein; pantophysin; Pan I; DNA segment, Chr 12, ERATO Doi 446, expressed	Symbol and Name updated	1299863	APPROVED
2005-07-29	LOC366595	similar to synaptophysin-like protein; pantophysin; Pan I; DNA segment, Chr 12, ERATO Doi 446, expressed			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar