Advanced Search (OLGA)

Gene: Yipf5 (Yip1 domain family, member 5) Rattus norvegicus

Analyze

Symbol:

Yipf5

Name:

Yip1 domain family, member 5

RGD ID:

1359165

Description:

Predicted to be involved in Golgi vesicle transport; insulin processing; and regulation of ER to Golgi vesicle-mediated transport. Predicted to act upstream of or within Golgi organization. Predicted to be located in several cellular components, including COPII-coated ER to Golgi transport vesicle; Golgi apparatus; and endoplasmic reticulum exit site. Predicted to be active in trans-Golgi network. Orthologous to human YIPF5 (Yip1 domain family member 5); INTERACTS WITH (+)-schisandrin B; 17alpha-ethynylestradiol; benzo[a]pyrene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Ac2-256; LOC361315; similar to Ac2-256; YIP1 family member 5; YPT-interacting protein 1 A

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	YIPF5 (Yip1 domain family member 5)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Yipf5 (Yip1 domain family, member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Yipf5 (Yip1 domain family member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	YIPF5 (Yip1 domain family member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	YIPF5 (Yip1 domain family member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Yipf5 (Yip1 domain family member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	YIPF5 (Yip1 domain family member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	YIPF5 (Yip1 domain family member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Yipf5 (Yip1 domain family member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Yipf5 (Yip1 domain family member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Yipf5 (Yip1 domain family, member 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	YIPF5 (Yip1 domain family member 5)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	yipf5 (Yip1 domain family, member 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	yipf5 (Yip1 domain family, member 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG12404	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F32D8.14	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	YIP1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	yipf5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	yipf5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	32,374,913 - 32,388,046 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	18	32,374,916 - 32,408,738 (-)	Ensembl				GRCr8
mRatBN7.2	18	32,123,814 - 32,136,947 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	32,123,842 - 32,157,642 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	18	32,227,984 - 32,241,117 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	32,971,005 - 32,984,151 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	32,323,247 - 32,336,380 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	18	32,539,224 - 32,552,366 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	18	32,122,499 - 32,135,641 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	18	32,136,889 - 32,150,031 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	18	32,233,863 - 32,246,996 (-)	NCBI		F344_StmMcwi
Rnor_6.0	18	33,401,103 - 33,436,885 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	33,401,106 - 33,434,775 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	18	33,075,375 - 33,111,270 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	18	33,249,184 - 33,262,317 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	18	31,744,527 - 31,757,660 (-)	NCBI		Celera
RGSC_v3.1	18	33,285,709 - 33,320,338 (-)	NCBI
Cytogenetic Map	18	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Microcephaly, Epilepsy, and Diabetes Syndrome 2 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

14-Deoxy-11,12-didehydroandrographolide (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-hydroxypropanoic acid (ISO)

4,4'-sulfonyldiphenol (ISO)

Aroclor 1254 (ISO)

benzo[a]pyrene (EXP)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

choline (ISO)

chromium(6+) (ISO)

ciguatoxin CTX1B (ISO)

clofibrate (ISO)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

cyproconazole (ISO)

Dibutyl phosphate (ISO)

dicrotophos (ISO)

doxorubicin (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

genistein (ISO)

ivermectin (ISO)

L-methionine (ISO)

lead diacetate (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

nimesulide (EXP)

ozone (ISO)

paracetamol (EXP)

phenobarbital (ISO)

propiconazole (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

senecionine (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

tetrachloromethane (EXP,ISO)

thapsigargin (EXP)

thiram (ISO)

titanium dioxide (ISO)

trichloroethene (ISO)

triphenyl phosphate (ISO)

Triptolide (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

endoplasmic reticulum to Golgi vesicle-mediated transport (IBA,IEA)

Golgi organization (ISO)

insulin processing (ISO,ISS)

protein transport (IEA)

regulation of ER to Golgi vesicle-mediated transport (IBA,ISO,ISS)

vesicle fusion with Golgi apparatus (IBA)

vesicle-mediated transport (IEA)

Cellular Component

COPII-coated ER to Golgi transport vesicle (IEA,ISO)

cytoplasmic vesicle (IEA)

endomembrane system (IEA)

endoplasmic reticulum (ISO)

endoplasmic reticulum exit site (ISO)

endoplasmic reticulum membrane (IEA)

Golgi apparatus (IEA,ISO)

Golgi membrane (IEA)

membrane (IEA)

nuclear outer membrane-endoplasmic reticulum membrane network (ISO)

trans-Golgi network (IBA)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:11489904	PMID:15254263	PMID:15489334

Genomics

Comparative Map Data

Yipf5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	32,374,913 - 32,388,046 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	18	32,374,916 - 32,408,738 (-)	Ensembl				GRCr8
mRatBN7.2	18	32,123,814 - 32,136,947 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	32,123,842 - 32,157,642 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	18	32,227,984 - 32,241,117 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	32,971,005 - 32,984,151 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	32,323,247 - 32,336,380 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	18	32,539,224 - 32,552,366 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	18	32,122,499 - 32,135,641 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	18	32,136,889 - 32,150,031 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	18	32,233,863 - 32,246,996 (-)	NCBI		F344_StmMcwi
Rnor_6.0	18	33,401,103 - 33,436,885 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	33,401,106 - 33,434,775 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	18	33,075,375 - 33,111,270 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	18	33,249,184 - 33,262,317 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	18	31,744,527 - 31,757,660 (-)	NCBI		Celera
RGSC_v3.1	18	33,285,709 - 33,320,338 (-)	NCBI
Cytogenetic Map	18	p11	NCBI

YIPF5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	144,158,162 - 144,170,659 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	144,158,162 - 144,170,714 (-)	Ensembl			hg38	GRCh38
GRCh37	5	143,537,726 - 143,550,223 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	143,517,919 - 143,530,387 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	5	139,619,111 - 139,631,663 (-)	NCBI		Celera
Cytogenetic Map	5	q31.3	NCBI
HuRef	5	138,685,376 - 138,697,926 (-)	NCBI		HuRef
CHM1_1	5	142,972,246 - 142,984,802 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	144,690,356 - 144,702,848 (-)	NCBI		T2T-CHM13v2.0

Yipf5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	40,337,918 - 40,352,452 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	40,336,949 - 40,352,482 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	18	40,204,865 - 40,219,399 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	40,203,896 - 40,219,429 (-)	Ensembl			mm10	GRCm38
MGSCv37	18	40,364,519 - 40,379,053 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	18	40,330,839 - 40,345,373 (-)	NCBI		MGSCv36	mm8
Celera	18	41,557,547 - 41,572,081 (-)	NCBI		Celera
Cytogenetic Map	18	B3	NCBI
cM Map	18	21.28	NCBI

Yipf5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	9,795,214 - 9,812,405 (+)	Ensembl
ChiLan1.0	NW_004955415	9,795,214 - 9,809,871 (+)	NCBI	ChiLan1.0	ChiLan1.0

YIPF5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	139,395,360 - 139,406,693 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	137,528,762 - 137,546,258 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	139,557,911 - 139,570,364 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	145,612,807 - 145,625,280 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	145,612,807 - 145,625,280 (-)	Ensembl			panPan2	panpan1.1

YIPF5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	38,894,687 - 38,907,487 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	38,895,995 - 38,907,422 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	35,940,091 - 35,952,894 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	39,347,925 - 39,360,732 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	39,343,164 - 39,360,711 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	36,420,546 - 36,433,335 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	37,233,996 - 37,246,789 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	38,036,907 - 38,049,724 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Yipf5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	148,691,533 - 148,707,183 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936504	10,265,477 - 10,282,108 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936504	10,265,506 - 10,278,522 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

YIPF5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	145,651,989 - 145,668,557 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	2	145,655,005 - 145,668,632 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

YIPF5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	46,765,326 - 46,777,245 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	46,766,484 - 46,777,244 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666034	31,059,302 - 31,072,166 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Yipf5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624774	3,399,250 - 3,414,740 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624774	3,398,368 - 3,414,926 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Yipf5
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	15	4,733,754 - 4,746,669 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Yipf5
77 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	305
Count of miRNA genes:	206
Interacting mature miRNAs:	233
Transcripts:	ENSRNOT00000020385, ENSRNOT00000040877
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25071126	83910656	Rat
2301409	Cm70	Cardiac mass QTL 70		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	18	7065728	52065728	Rat
1358358	Sradr6	Stress Responsive Adrenal Weight QTL 6	2.49		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	18	22015562	61600538	Rat
1331798	Bp224	Blood pressure QTL 224	3.53873		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	77371277	Rat
2301413	Bp318	Blood pressure QTL 318		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	26822186	71822186	Rat
61383	Bp47	Blood pressure QTL 47	17.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	31522783	76522783	Rat
12904716	Am21	Aortic mass QTL 21		0.005	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	7065728	52065728	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	23494057	85487725	Rat
1331742	Bp228	Blood pressure QTL 228	3.88752		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	77371277	Rat
12904714	Cm131	Cardiac mass QTL 131		0.002	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	7065728	52065728	Rat
12904715	Cm132	Cardiac mass QTL 132		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	7065728	52065728	Rat
1331776	Bp225	Blood pressure QTL 225	2.829		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	31610505	77371277	Rat
6903345	Bp349	Blood pressure QTL 349	3.9		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	3917226	48917226	Rat
12904668	Bw188	Body weight QTL 188		0.03	body mass (VT:0001259)	body weight (CMO:0000012)	18	26822186	71822186	Rat
2313082	Bss85	Bone structure and strength QTL 85	0.8	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	18	15226101	42690662	Rat
12904669	Cm125	Cardiac mass QTL 125		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	26822186	71822186	Rat
12904670	Cm126	Cardiac mass QTL 126		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	26822186	71822186	Rat
1641923	Colcr8	Colorectal carcinoma resistance QTL 8	3.1	0.0014	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	18	31990891	76990891	Rat
2312568	Glom21	Glomerulus QTL 21	2	0.005	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	18	5460455	42690191	Rat
1331727	Bp237	Blood pressure QTL 237	3.053		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	63968306	Rat
6903349	Bp351	Blood pressure QTL 351	3.5		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	3917226	48917226	Rat
631509	Sald2	Serum aldosterone level QTL 2	2.9		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	18	26415821	71415821	Rat
6903351	Bp352	Blood pressure QTL 352	3.3		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	3917226	48917226	Rat
12904677	Kidm72	Kidney mass QTL 72		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	26822186	71822186	Rat
631274	Sprol1	Serum protein level QTL 1	5.3		blood total protein amount (VT:0005567)	serum total protein level (CMO:0000661)	18	31644508	79484311	Rat
12904673	Cm127	Cardiac mass QTL 127		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	26822186	71822186	Rat
12904675	Am19	Aortic mass QTL 19		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	26822186	71822186	Rat
1331774	Bp226	Blood pressure QTL 226	4.41065		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	77371277	Rat
9589816	Gluco68	Glucose level QTL 68	7.25	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	31990891	76990891	Rat
2325839	Bp348	Blood pressure QTL 348		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	1	44930869	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19553532	85493247	Rat
2293708	Bss46	Bone structure and strength QTL 46	8.8	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	18	12066482	57066482	Rat
8694378	Bw157	Body weight QTL 157	3.59	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	31990891	76990891	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	12066482	85493247	Rat
2303120	Mamtr8	Mammary tumor resistance QTL 8		0.001	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	31610505	85493247	Rat
61429	Cia17	Collagen induced arthritis QTL 17	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	31610505	72538878	Rat
2300180	Bmd67	Bone mineral density QTL 67	4.8	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	18	1	34566578	Rat
2299160	Iddm35	Insulin dependent diabetes mellitus QTL 35	2.79		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	18	4482648	49482648	Rat
9590318	Scort22	Serum corticosterone level QTL 22	7.64	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	18	31990891	76990891	Rat
1331753	Bp231	Blood pressure QTL 231	3.643		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	1	54490981	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	12066482	85493247	Rat
11565454	Kidm59	Kidney mass QTL 59		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	7065728	52065728	Rat
1331754	Bp230	Blood pressure QTL 230	4.61609		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	15642280	86134022	Rat
2293661	Bss50	Bone structure and strength QTL 50	4.64	0.0003	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	18	1	34566578	Rat
61375	Bp41	Blood pressure QTL 41	2.4		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	18	4307354	49307354	Rat

Markers in Region

BE111849

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	32,124,125 - 32,124,215 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	33,401,415 - 33,401,504	NCBI	Rnor6.0
Rnor_5.0	18	33,075,687 - 33,075,776	UniSTS	Rnor5.0
RGSC_v3.4	18	33,249,496 - 33,249,585	UniSTS	RGSC3.4
Celera	18	31,744,839 - 31,744,928	UniSTS
RH 3.4 Map	18	450.5	UniSTS
Cytogenetic Map	18	p11	UniSTS

RH137277

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	32,137,656 - 32,137,855 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	33,414,946 - 33,415,144	NCBI	Rnor6.0
Rnor_5.0	18	33,089,218 - 33,089,416	UniSTS	Rnor5.0
RGSC_v3.4	18	33,263,027 - 33,263,225	UniSTS	RGSC3.4
Celera	18	31,758,370 - 31,758,568	UniSTS
Cytogenetic Map	18	p11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001014150	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY321347	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC083754	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473974	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000020385 ⟹ ENSRNOP00000020385

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	18	32,374,916 - 32,388,046 (-)	Ensembl
mRatBN7.2 Ensembl	18	32,123,842 - 32,136,945 (-)	Ensembl
Rnor_6.0 Ensembl	18	33,401,106 - 33,414,236 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000040877 ⟹ ENSRNOP00000041654

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	18	32,376,173 - 32,408,738 (-)	Ensembl
mRatBN7.2 Ensembl	18	32,125,074 - 32,157,642 (-)	Ensembl
Rnor_6.0 Ensembl	18	33,402,363 - 33,434,775 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000117916 ⟹ ENSRNOP00000082127

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	18	32,376,173 - 32,408,738 (-)	Ensembl
mRatBN7.2 Ensembl	18	32,125,074 - 32,157,642 (-)	Ensembl

RefSeq Acc Id:

NM_001014150 ⟹ NP_001014172

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	32,374,913 - 32,388,046 (-)	NCBI
mRatBN7.2	18	32,123,814 - 32,136,947 (-)	NCBI
Dahl_SR_JrHsd	18	32,539,224 - 32,552,366 (-)	NCBI
Lyon_Normotensive	18	32,122,499 - 32,135,641 (-)	NCBI
Lyon_Hypertensive	18	32,136,889 - 32,150,031 (-)	NCBI
F344_StmMcwi	18	32,233,863 - 32,246,996 (-)	NCBI
Rnor_6.0	18	33,401,103 - 33,414,236 (-)	NCBI
Rnor_5.0	18	33,075,375 - 33,111,270 (-)	NCBI
RGSC_v3.4	18	33,249,184 - 33,262,317 (-)	RGD
Celera	18	31,744,527 - 31,757,660 (-)	RGD

Sequence:

show sequence

GTAGCAACAGGGCTACTGCCGGGTCTGGAACTGAGTTTGGGGGGTTACTAAGGGCCGCAGGAGC
TGCAGCCGCTGCCGCCGCTGGAGCGTTTGATCGTTTGAAATGTCAGGCTTTGATAACTTAAACA
GCGGTTTCTACCAGACAAGTTACAGCATCGATGAGCAATCTCAGCAGTCCTATGACTATGGAGG
AAGTGGAGGACCCTACAGCAAGCAGTATGCTGGCTGTGAGTACTCTCAGCAAGGCCGATTCGTC
CCTCCAGACATGATGCAGCCTCAGCAGACGTACACTGGGCAGATTTACCAGCCCACTCAGGCCT
ATCCGCCACCTACACCTCAGACATTCTATGGAGACAGCTTTGAGGAGGAGCCCCCTTTGCTAGA
AGAGTTGGGTATCAATTTTGACCACATTTGGCAAAAAACGCTGACGGTGCTTCACCCGCTGAGG
GCATCTGATGGCAGCATCATGAATGAGACCGACTTGGCAGGGCCAGTGGTGTTCTGCCTTGCCT
TCGGGGCCACACTGCTACTGGCGGGCAAAATCCAGTTTGGCTATGTGTACGGGATCAGTGCAAT
TGGATGTTTAGGAATGTTTTGTTTGTTAAATTTAATGAGTATGACAGGTGTCTCATTTGGTTGT
GTGGCAAGTGTCCTGGGATATTGTCTTCTTCCCATGATCCTGCTGTCCAGCTTTGCAGTGGTAT
TTTCTTTACAAGGAATGGTAGGAATTCTTCTCACTGCCACAATTATTGGATGGTGTAGTTTTTC
TGCTTCCAAAATCTTTATTTCTGCATTAGCTATGGATGGACAACAACTTTTAGTGGCATATCCC
TGTGCTTTGTTGTATGGAGTCTTTGCCCTGATTTCCGTCTTTTGAACTGATTTTGTCTGGGACA
TGGATATCTGTGGGCCGGATTCATAAAAAGGACCTTGGACTCTTAAAATTGGACCAGCAAATTC
CTGCAGTACAGCTCATTCCGCTTGCCAGTAGTCTGGAAGCAACAGAAGTAGACAAGTCGTGTTC
ATCTGTACAGGAAGTTGAGCACAGTGGAGTCACCTGTTGGCTACTCTCTGAGTGTGCTTAGACC
GCTAAGAAGTGCGGTCGATGTCTTTCCTGACCCTGCAGCCTTTAACAAACAATTCTTCTTCCTT
ACAAATTATGATAGGATGTTTTTGATAGATTTTTACCAAGTGGAAAACCAACCACAAAGCTGAT
AATCTTTCTTAGAAACACCCAGTTAGAGTTAAAGAAGAAACCAATTTTACCACGGAAATATTTT
TCAAAGGAATTAGGAAAGAACATACTCGCTGCATCCTCAAGATCAATGCACTGAGTTAAAGCTG
AACAAAACAGGATCCCAGTGTAGAGCTTCTGAGTTTGCACCTCAAATATTCCACATTCCTATAA
GTTGTCTCATGAAATCTGTGTTGAGAGTCAGATACAAGCAGTTCCCGGTCTACCTTACTGTAGA
GATGAAATGTGAACAGCTCTTTAGACATGAGTGTCAGCTAAATCTGGACTGGCCACATGAATGC
TTAGTTCTGTCTCCACATGTCCCAGGAAAAAGAAATCACCAAGTTTTGAGAAAACAATATTTAA
AATTTCACAATTTCAGTATTGCATTATCGATGTATAGTGGATTTGATGCTTATTAAATTTTTCC
CAATTAAACTCTGCTGTGGAGTTTACTTTCTCTAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001014172	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH83754	(Get FASTA)	NCBI Sequence Viewer
	AAP86279	(Get FASTA)	NCBI Sequence Viewer
	EDL76464	(Get FASTA)	NCBI Sequence Viewer
	EDL76465	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000020385
	ENSRNOP00000020385.2
GenBank Protein	Q5XID0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001014172 ⟸ NM_001014150

- UniProtKB:

Q5XID0 (UniProtKB/Swiss-Prot), A6J3I2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSGFDNLNSGFYQTSYSIDEQSQQSYDYGGSGGPYSKQYAGCEYSQQGRFVPPDMMQPQQTYTG
QIYQPTQAYPPPTPQTFYGDSFEEEPPLLEELGINFDHIWQKTLTVLHPLRASDGSIMNETDLA
GPVVFCLAFGATLLLAGKIQFGYVYGISAIGCLGMFCLLNLMSMTGVSFGCVASVLGYCLLPMI
LLSSFAVVFSLQGMVGILLTATIIGWCSFSASKIFISALAMDGQQLLVAYPCALLYGVFALISV
F

hide sequence

Ensembl Acc Id:

ENSRNOP00000020385 ⟸ ENSRNOT00000020385

Ensembl Acc Id:

ENSRNOP00000041654 ⟸ ENSRNOT00000040877

Ensembl Acc Id:

ENSRNOP00000082127 ⟸ ENSRNOT00000117916

Protein Domains

Yip1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5XID0-F1-model_v2	AlphaFold	Q5XID0	1-257	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700745

Promoter ID:

EPDNEW_R11268

Type:

multiple initiation site

Name:

Yipf5_1

Description:

Yip1 domain family, member 5

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	18	33,414,256 - 33,414,316	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359165	AgrOrtholog
BioCyc Gene	G2FUF-7737	BioCyc
Ensembl Genes	ENSRNOG00000014564	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000020385	ENTREZGENE
	ENSRNOT00000020385.6	UniProtKB/Swiss-Prot
InterPro	Yip1/4-like	UniProtKB/Swiss-Prot
	Yip1_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:361315	UniProtKB/Swiss-Prot
NCBI Gene	361315	ENTREZGENE
PANTHER	PROTEIN YIPF5	UniProtKB/Swiss-Prot
	PTHR21236	UniProtKB/Swiss-Prot
Pfam	Yip1	UniProtKB/Swiss-Prot
PhenoGen	Yipf5	PhenoGen
RatGTEx	ENSRNOG00000014564	RatGTEx
UniProt	A0A8I5ZUJ6_RAT	UniProtKB/TrEMBL
	A6J3I2	ENTREZGENE, UniProtKB/TrEMBL
	A6J3I3_RAT	UniProtKB/TrEMBL
	Q5XID0	ENTREZGENE
	Q7TPI8_RAT	UniProtKB/TrEMBL
	YIPF5_RAT	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Yipf5	Yip1 domain family, member 5	LOC361315	similar to Ac2-256	Symbol and Name updated	1299863	APPROVED
2005-07-29	LOC361315	similar to Ac2-256			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM