Advanced Search (OLGA)

Gene: Or10j5 (olfactory receptor family 10 subfamily J member 5) Rattus norvegicus

Analyze

Symbol:

Or10j5

Name:

olfactory receptor family 10 subfamily J member 5

RGD ID:

1333702

Description:

Predicted to enable olfactory receptor activity. Predicted to be involved in several processes, including G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger; detection of chemical stimulus involved in sensory perception of smell; and regulation of angiogenesis. Predicted to be located in membrane. Predicted to be active in plasma membrane. Orthologous to human OR10J5 (olfactory receptor family 10 subfamily J member 5); INTERACTS WITH acetamide; bisphenol A; vinclozolin.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

olfactory receptor 1576; olfactory receptor gene Olr1576; olfactory receptor Olr1576; Olr1576

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	87,962,973 - 87,963,902 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	87,962,973 - 87,963,902 (+)	Ensembl				GRCr8
mRatBN7.2	13	85,430,655 - 85,431,584 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	85,424,254 - 85,432,107 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	87,928,998 - 87,929,927 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	89,329,293 - 89,330,222 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	86,514,003 - 86,514,932 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	91,481,461 - 91,482,390 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	91,481,461 - 91,482,390 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	95,994,475 - 95,995,404 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	89,170,387 - 89,171,316 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	85,035,965 - 85,036,894 (+)	NCBI		Celera
RGSC_v3.1	13	89,359,270 - 89,360,200 (+)	NCBI
Cytogenetic Map	13	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

acetamide (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

CGP 52608 (ISO)

dexamethasone (ISO)

dichloroacetic acid (ISO)

indometacin (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

chemotaxis (ISO)

detection of chemical stimulus involved in sensory perception of smell (IEA)

G protein-coupled receptor signaling pathway (IEA)

G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger (ISO)

lipid homeostasis (ISO)

regulation of angiogenesis (ISO)

regulation of muscle cell differentiation (ISO)

sensory perception of smell (IEA,ISO)

signal transduction (IEA)

Cellular Component

membrane (IEA)

plasma membrane (IEA,ISO)

Molecular Function

G protein-coupled receptor activity (IEA)

olfactory receptor activity (IEA,ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

taste/olfaction phenotype (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Genome sequence of the Brown Norway rat yields insights into mammalian evolution.	Gibbs RA, etal., Nature 2004 Apr 1;428(6982):493-521.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Or10j5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	87,962,973 - 87,963,902 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	87,962,973 - 87,963,902 (+)	Ensembl				GRCr8
mRatBN7.2	13	85,430,655 - 85,431,584 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	85,424,254 - 85,432,107 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	87,928,998 - 87,929,927 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	89,329,293 - 89,330,222 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	86,514,003 - 86,514,932 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	91,481,461 - 91,482,390 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	91,481,461 - 91,482,390 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	95,994,475 - 95,995,404 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	89,170,387 - 89,171,316 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	85,035,965 - 85,036,894 (+)	NCBI		Celera
RGSC_v3.1	13	89,359,270 - 89,360,200 (+)	NCBI
Cytogenetic Map	13	q24	NCBI

OR10J5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	159,535,078 - 159,536,007 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	159,535,078 - 159,536,007 (-)	Ensembl			hg38	GRCh38
GRCh37	1	159,504,868 - 159,505,797 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	157,771,492 - 157,772,421 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	156,317,940 - 156,318,870	NCBI
Celera	1	132,574,270 - 132,575,199 (-)	NCBI		Celera
Cytogenetic Map	1	q23.2	NCBI
HuRef	1	130,861,928 - 130,862,857 (-)	NCBI		HuRef
CHM1_1	1	160,900,347 - 160,901,276 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	158,672,150 - 158,673,079 (-)	NCBI		T2T-CHM13v2.0

Or10j5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	172,784,335 - 172,785,384 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	172,777,976 - 172,785,924 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	172,956,768 - 172,957,817 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	172,950,409 - 172,958,357 (+)	Ensembl			mm10	GRCm38
MGSCv37	1	174,886,899 - 174,887,948 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	174,793,472 - 174,794,401 (+)	NCBI		MGSCv36	mm8
Celera	1	175,804,768 - 175,805,817 (+)	NCBI		Celera
Cytogenetic Map	1	H3	NCBI
cM Map	1	80.33	NCBI

LOC100973313
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	90,322,225 - 90,325,689 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	90,059,875 - 90,063,338 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	134,881,761 - 134,883,765 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	138,679,408 - 138,680,445 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	138,679,477 - 138,680,406 (-)	Ensembl			panPan2	panpan1.1

OR10J14
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	38	22,471,969 - 22,473,711 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	38	22,549,117 - 22,550,040 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	38	22,595,193 - 22,596,119 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	38	22,595,193 - 22,596,119 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	38	22,361,545 - 22,362,467 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	38	22,894,063 - 22,894,989 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	38	23,305,365 - 23,306,291 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

LOC101970211
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	5,705,790 - 5,706,810 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936740	1,040,510 - 1,048,637 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936740	1,047,708 - 1,048,645 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LOC100517340
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	90,942,304 - 90,943,233 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	90,939,738 - 90,945,036 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	98,937,550 - 98,939,697 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

OR10J5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	4,401,134 - 4,403,747 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666038	3,531,244 - 3,532,648 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Or10j5
8 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	14
Count of miRNA genes:	11
Interacting mature miRNAs:	14
Transcripts:	ENSRNOT00000012103
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
738027	Lnnr6	Liver neoplastic nodule remodeling QTL 6	3.3		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	65613454	109350286	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	21120177	109350286	Rat
7387280	Uae43	Urinary albumin excretion QTL 43	5.69	0.4174	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	68983334	109350286	Rat
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	48639634	93639634	Rat
738026	Lnnr5	Liver neoplastic nodule remodeling QTL 5	3.29		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	62424592	88113509	Rat
10755495	Bp387	Blood pressure QTL 387	3.78		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	37216241	90057603	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	67635937	109350286	Rat
1576318	Schws5	Schwannoma susceptibility QTL 5		0.0351	nervous system integrity trait (VT:0010566)	post-insult time to trigeminal nerve neurilemmoma formation (CMO:0002019)	13	64497900	109350286	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	11081740	103588154	Rat
1581554	Pur11	Proteinuria QTL 11			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	38975045	103588154	Rat
8655951	Rf63	Renal function QTL 63	12.2		blood urea nitrogen amount (VT:0005265)	plasma urea nitrogen level (CMO:0000586)	13	71610804	109350286	Rat
4889606	Gluco63	Glucose level QTL 63	2.86	0.003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	83286150	109350286	Rat
8655945	Rf61	Renal function QTL 61	3.6		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	13	71610804	89333251	Rat
1331783	Bp221	Blood pressure QTL 221	3.72886		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	71610804	89333251	Rat
8655959	Pur32	Proteinuria QTL 32	8.4		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	72984506	99745408	Rat
1300166	Kidm6	Kidney mass QTL 6	3.93		kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	13	71610804	89333251	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	67635937	109350286	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	64375743	109350286	Rat
1581573	Uae36	Urinary albumin excretion QTL 36			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	103588154	Rat
724564	Uae11	Urinary albumin excretion QTL 11	5.7		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	13	47354258	94285672	Rat
2293341	Glom15	Glomerulus QTL 15	9.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	13	67635937	109350286	Rat

Markers in Region

Olfr16

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	85,430,845 - 85,431,578 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	91,481,652 - 91,482,384	NCBI	Rnor6.0
Rnor_5.0	13	95,994,666 - 95,995,398	UniSTS	Rnor5.0
Celera	13	85,036,156 - 85,036,888	UniSTS
Cytogenetic Map	13	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

ectoderm	endocrine system	endoderm	exocrine system	hepatobiliary system	mesenchyme	nervous system
13	13	13	13	13	13	13

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001000499	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000012103 ⟹ ENSRNOP00000012103

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	85,424,254 - 85,432,107 (+)	Ensembl
Rnor_6.0 Ensembl	13	91,481,461 - 91,482,390 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000151771 ⟹ ENSRNOP00000099726

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	87,962,973 - 87,963,902 (+)	Ensembl

RefSeq Acc Id:

NM_001000499 ⟹ NP_001000499

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	87,962,973 - 87,963,902 (+)	NCBI
mRatBN7.2	13	85,430,655 - 85,431,584 (+)	NCBI
Rnor_6.0	13	91,481,461 - 91,482,390 (+)	NCBI
Rnor_5.0	13	95,994,475 - 95,995,404 (+)	NCBI
RGSC_v3.4	13	89,170,387 - 89,171,316 (+)	RGD
Celera	13	85,035,965 - 85,036,894 (+)	RGD

Sequence:

show sequence

ATGCAGAGAATGAACTTCACTGAAGTGACAGAGTTCATCTTCCTGGGATTCTCTAGCTTTGGAA
AGCATCAAATAACCCTCTTTGTAGTTTTCCTAACCATCTACATTTTAACTCTGGCGGGAAACTT
CATTATAGTGACAATCACATATATGGACCGTCACCTTCACACTCCCATGTACTTCTTTCTGAGC
ATGTTGGCAAGTTCAGAGACTGTATACACACTGGTCATTGTCCCAAGAATGCTTTCCAGCCTGA
TTTTTTATGACCTTCCCATATCCTTGGCAGGTTGTGCAACCCAAATGTTCTTTTTTGTCACCTT
GGCCACCAACAACTGCTTTCTGCTCACAGCAATGGGTTATGATCGCTATGTGGCCATTTGTGAG
CCTTTGAGATATACGGTCATCATGAGCAAAGGGTTGTGTGCCTGGTTGGTTTGTGGGTCTTTAG
GCACTGGTCTAGTAATGGCAGTTCTCCATGTGCCAGCCATGTTCCATTTGCCCTTCTGTGGCAC
AGTGGTGGAGCACTTTTTCTGTGACATATACCCAGTAATGAAGCTTTCTTGTGTTGATACCACT
GTCAATGAGATAATCAATTATGGTGTAAGTTCATTTGTGATTCTTGTGCCCATAGGGCTGATAT
TTATCTCCTATGTCCTCATTGTTTCTTCCATCCTTAAAATTGTGTCCACTGAAGGCCAGAAGAA
AGCCTTTGCCACCTGTGCCTCTCATCTCACTGTGGTCATTGTTCACTACGGCTGTGCGTCCATT
GCCTACCTCAAACCCAAGTCAGAAAGTTCAGTAGAAAAAGACCTTCTCCTCTCAGTGACCTATA
TCATCATCACTCCCTTGCTGAACCCTGTTGTCTACAGTCTTAGGAACAAAGAGGTCAAAGATGC
TTTATGCAGAGCTGTGGGCAGAAACATTTCTTAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001000499	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL94730	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000099726
	ENSRNOP00000099726.1

RefSeq Acc Id:

NP_001000499 ⟸ NM_001000499

- UniProtKB:

D3ZB83 (UniProtKB/TrEMBL), A6JG74 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MQRMNFTEVTEFIFLGFSSFGKHQITLFVVFLTIYILTLAGNFIIVTITYMDRHLHTPMYFFLS
MLASSETVYTLVIVPRMLSSLIFYDLPISLAGCATQMFFFVTLATNNCFLLTAMGYDRYVAICE
PLRYTVIMSKGLCAWLVCGSLGTGLVMAVLHVPAMFHLPFCGTVVEHFFCDIYPVMKLSCVDTT
VNEIINYGVSSFVILVPIGLIFISYVLIVSSILKIVSTEGQKKAFATCASHLTVVIVHYGCASI
AYLKPKSESSVEKDLLLSVTYIIITPLLNPVVYSLRNKEVKDALCRAVGRNIS

hide sequence

Ensembl Acc Id:

ENSRNOP00000012103 ⟸ ENSRNOT00000012103

Ensembl Acc Id:

ENSRNOP00000099726 ⟸ ENSRNOT00000151771

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZB83-F1-model_v2	AlphaFold	D3ZB83	1-309	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1333702	AgrOrtholog
BioCyc Gene	G2FUF-17288	BioCyc
Ensembl Genes	ENSRNOG00000009141	Ensembl
	ENSRNOG00000091073	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000151771	ENTREZGENE
	ENSRNOT00000151771.1	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	7TM_GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR_Rhodpsn_supfam	UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/TrEMBL
KEGG Report	rno:304985	UniProtKB/TrEMBL
NCBI Gene	304985	ENTREZGENE
PANTHER	OLFACTORY RECEPTOR	UniProtKB/TrEMBL
Pfam	7tm_4	UniProtKB/TrEMBL
PhenoGen	Or10j5	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000009141	RatGTEx
	ENSRNOG00000091073	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	A0ABK0KY02_RAT	UniProtKB/TrEMBL
	A6JG74	ENTREZGENE, UniProtKB/TrEMBL
	D3ZB83	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-08-16	Or10j5	olfactory receptor family 10 subfamily J member 5	Olr1576	olfactory receptor 1576	Symbol and Name Changed	1299863	APPROVED
2008-04-30	Olr1576	olfactory receptor 1576	Olr1576_predicted	olfactory receptor 1576 (predicted)	'predicted' is removed	2292626	APPROVED
2005-02-04	Olr1576_predicted	olfactory receptor 1576 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Mammalian Phenotype