Advanced Search (OLGA)

Gene: Laptm4b (lysosomal protein transmembrane 4 beta) Rattus norvegicus

Analyze

Symbol:

Laptm4b

Name:

lysosomal protein transmembrane 4 beta

RGD ID:

1311853

Description:

Predicted to enable ceramide binding activity; enzyme binding activity; and phosphatidylinositol bisphosphate binding activity. Predicted to be involved in several processes, including endosome transport via multivesicular body sorting pathway; negative regulation of macromolecule metabolic process; and regulation of lysosomal membrane permeability. Predicted to be located in several cellular components, including endosome; lysosome; and plasma membrane. Predicted to be active in lysosomal membrane. Orthologous to human LAPTM4B (lysosomal protein transmembrane 4 beta); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC315047; lysosomal-associated protein transmembrane 4B; lysosomal-associated transmembrane protein 4B

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	LAPTM4B (lysosomal protein transmembrane 4 beta)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Laptm4b (lysosomal-associated protein transmembrane 4B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Laptm4b (lysosomal protein transmembrane 4 beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LAPTM4B (lysosomal protein transmembrane 4 beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	LAPTM4B (lysosomal protein transmembrane 4 beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Laptm4b (lysosomal protein transmembrane 4 beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	LAPTM4B (lysosomal protein transmembrane 4 beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LAPTM4B (lysosomal protein transmembrane 4 beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Laptm4b (lysosomal protein transmembrane 4 beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Laptm4b (lysosomal protein transmembrane 4 beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	LAPTM4B (lysosomal protein transmembrane 4 beta)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Laptm4b (lysosomal-associated protein transmembrane 4B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	laptm4b (lysosomal protein transmembrane 4 beta)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG14767	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG14767	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	laptm4b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	laptm4b	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	67,319,438 - 67,362,547 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	67,319,542 - 67,363,258 (+)	Ensembl				GRCr8
mRatBN7.2	7	65,434,525 - 65,477,386 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	65,434,394 - 65,477,383 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	67,323,714 - 67,366,569 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	69,525,436 - 69,568,294 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	69,391,712 - 69,434,580 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	72,924,911 - 72,968,099 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	72,924,799 - 72,968,101 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	73,094,975 - 73,138,163 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	69,654,990 - 69,697,852 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	62,539,514 - 62,582,361 (+)	NCBI		Celera
RGSC_v3.1	7	69,675,719 - 69,718,578 (+)	NCBI
Cytogenetic Map	7	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,4-methylenedioxymethamphetamine (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-diaminodiphenylmethane (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

all-trans-retinoic acid (ISO)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium dichloride (ISO)

chloropicrin (ISO)

cisplatin (ISO)

clobetasol (ISO)

copper atom (ISO)

copper(0) (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

diuron (EXP)

doxorubicin (ISO)

ethanol (ISO)

folic acid (ISO)

ketamine (EXP)

methoxychlor (EXP)

nimesulide (EXP)

oxaliplatin (EXP)

paracetamol (EXP,ISO)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

PhIP (EXP)

pirinixic acid (ISO)

rac-lactic acid (ISO)

rotenone (ISO)

sodium arsenite (ISO)

temozolomide (ISO)

testosterone (EXP)

tetrachloromethane (EXP)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

topotecan (EXP)

triclosan (ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

trovafloxacin (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

endosome organization (IEA,ISO,ISS)

endosome transport via multivesicular body sorting pathway (IEA,ISO,ISS)

negative regulation of lysosomal protein catabolic process (IEA,ISO,ISS)

negative regulation of transforming growth factor beta1 production (IEA,ISO,ISS)

regulation of lysosomal membrane permeability (IBA,IEA,ISO,ISS)

regulation of lysosome organization (IEA,ISO,ISS)

Cellular Component

cell projection (IEA,ISO,ISS)

early endosome (IEA,ISO,ISS)

endomembrane system (IEA)

endosome (IEA,ISO,ISS)

endosome membrane (IEA)

late endosome membrane (IEA,ISO,ISS)

lysosomal membrane (IBA,IEA,ISO,ISS)

lysosome (IEA,ISO,ISS)

membrane (IEA)

multivesicular body membrane (IEA,ISO,ISS)

multivesicular body, internal vesicle (IEA,ISO,ISS)

plasma membrane (IEA,ISO,ISS)

Molecular Function

ceramide binding (IEA,ISO,ISS)

kinase binding (IEA,ISO)

phosphatidylinositol bisphosphate binding (IEA,ISO,ISS)

protein binding (ISO)

ubiquitin protein ligase binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334	PMID:21224396	PMID:22096579	PMID:25588945	PMID:26126825	PMID:26280656	PMID:32693673

Genomics

Comparative Map Data

Laptm4b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	67,319,438 - 67,362,547 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	67,319,542 - 67,363,258 (+)	Ensembl				GRCr8
mRatBN7.2	7	65,434,525 - 65,477,386 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	65,434,394 - 65,477,383 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	67,323,714 - 67,366,569 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	69,525,436 - 69,568,294 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	69,391,712 - 69,434,580 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	72,924,911 - 72,968,099 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	72,924,799 - 72,968,101 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	73,094,975 - 73,138,163 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	69,654,990 - 69,697,852 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	62,539,514 - 62,582,361 (+)	NCBI		Celera
RGSC_v3.1	7	69,675,719 - 69,718,578 (+)	NCBI
Cytogenetic Map	7	q22	NCBI

LAPTM4B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	97,775,788 - 97,853,013 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	97,775,057 - 97,853,013 (+)	Ensembl			hg38	GRCh38
GRCh37	8	98,788,016 - 98,865,241 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	98,856,985 - 98,934,006 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	8	98,856,984 - 98,933,998	NCBI
Celera	8	94,973,714 - 95,050,765 (+)	NCBI		Celera
Cytogenetic Map	8	q22.1	NCBI
HuRef	8	93,993,667 - 94,068,953 (+)	NCBI		HuRef
CHM1_1	8	98,828,294 - 98,905,316 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	8	98,901,267 - 98,978,513 (+)	NCBI		T2T-CHM13v2.0

Laptm4b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	34,238,279 - 34,284,448 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	34,238,174 - 34,284,448 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	15	34,238,026 - 34,284,295 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	34,238,028 - 34,284,302 (+)	Ensembl			mm10	GRCm38
MGSCv37	15	34,167,781 - 34,214,050 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	15	34,182,615 - 34,228,884 (+)	NCBI		MGSCv36	mm8
Celera	15	34,858,574 - 34,904,967 (+)	NCBI		Celera
Cytogenetic Map	15	B3.1	NCBI
cM Map	15	13.98	NCBI

Laptm4b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955417	13,574,721 - 13,625,313 (+)	Ensembl
ChiLan1.0	NW_004955417	13,574,493 - 13,625,669 (+)	NCBI	ChiLan1.0	ChiLan1.0

LAPTM4B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	115,118,902 - 115,196,183 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	90,660,516 - 90,737,745 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	94,414,275 - 94,491,483 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	96,600,799 - 96,677,927 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	96,600,799 - 96,677,927 (+)	Ensembl			panPan2	panpan1.1

LAPTM4B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	41,134 - 127,399 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	13	41,121 - 127,182 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	32,510 - 121,655 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	189,696 - 275,803 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	13	189,690 - 278,080 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	13	33,907 - 119,927 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	141,792 - 227,784 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	147,644 - 233,653 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Laptm4b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	37,491,363 - 37,555,672 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936470	44,914,011 - 44,982,065 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936470	44,917,462 - 44,981,773 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LAPTM4B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	38,932,742 - 39,023,925 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	38,932,735 - 39,015,219 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	41,977,266 - 42,060,047 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LAPTM4B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	92,695,445 - 92,771,935 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666039	47,990,959 - 48,066,846 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Laptm4b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624763	4,991,548 - 5,038,138 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624763	4,991,562 - 5,036,624 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Laptm4b
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	207,938,347 - 207,981,363 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Laptm4b
277 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	112
Count of miRNA genes:	89
Interacting mature miRNAs:	94
Transcripts:	ENSRNOT00000008969
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7411569	Bw137	Body weight QTL 137		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	23807606	68807606	Rat
10053722	Scort27	Serum corticosterone level QTL 27	2.41	0.0083	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	45113903	90113903	Rat
1549840	Bss5	Bone structure and strength QTL 5	9.8		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	7	26638057	71638057	Rat
1300127	Srn1	Serum renin concentration QTL 1	3.87		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	7	24179478	86817926	Rat
10059605	Kidm47	Kidney mass QTL 47	2.91	0.05	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	49137999	67614020	Rat
1357336	Gluco6	Glucose level QTL 6	3.4		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	7	51700643	96700643	Rat
1358361	Sradr5	Stress Responsive Adrenal Weight QTL 5	5.55		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	7	31770293	110435881	Rat
1298525	Cm1	Cardiac mass QTL 1	2.7		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	7	56625161	101625161	Rat
631513	Scl7	Serum cholesterol level QTL 7	4.1		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	39845902	84845902	Rat
10755453	Coatc12	Coat color QTL 12		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	32998702	77998702	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	46307490	127866166	Rat
7411605	Foco14	Food consumption QTL 14	24.1	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	36178764	81178764	Rat
1300151	Bp181	Blood pressure QTL 181	3.36		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	7	55498584	105834451	Rat
1559283	Emca4	Estrogen-induced mammary cancer QTL 4	3.7		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	7	63889858	108889858	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	10112916	99900612	Rat
738030	Anxrr8	Anxiety related response QTL 8	4.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	48475049	93475049	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	1	104117804	Rat
631534	Lnnr1	Liver neoplastic nodule remodeling QTL 1	3.85	0.001	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	7	36178764	81178764	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	1509236	116977875	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	40540077	123682549	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	49682832	115766396	Rat
1298528	Bp169	Blood pressure QTL 169		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	62963207	107963207	Rat
1300132	Bp182	Blood pressure QTL 182	3.49		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	21541977	86817926	Rat
1576303	Ept7	Estrogen-induced pituitary tumorigenesis QTL 7	3.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	7	63889858	108889858	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	49682832	115766396	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	49682832	115766396	Rat
2303582	Gluco53	Glucose level QTL 53	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	7	48603087	93603087	Rat
61439	Cia8	Collagen induced arthritis QTL 8	5.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	7	27182914	72182914	Rat

Markers in Region

RH128820

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	65,477,225 - 65,477,375 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	72,967,942 - 72,968,091	NCBI	Rnor6.0
Rnor_5.0	7	73,138,006 - 73,138,155	UniSTS	Rnor5.0
RGSC_v3.4	7	69,697,695 - 69,697,844	UniSTS	RGSC3.4
Celera	7	62,582,204 - 62,582,353	UniSTS
Cytogenetic Map	7	q22	UniSTS

RH134681

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	65,476,486 - 65,476,691 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	72,967,203 - 72,967,407	NCBI	Rnor6.0
Rnor_5.0	7	73,137,267 - 73,137,471	UniSTS	Rnor5.0
RGSC_v3.4	7	69,696,956 - 69,697,160	UniSTS	RGSC3.4
Celera	7	62,581,465 - 62,581,669	UniSTS
Cytogenetic Map	7	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001013174	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039079227	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC086442	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214299	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234072	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000008969 ⟹ ENSRNOP00000008969

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	67,319,542 - 67,363,258 (+)	Ensembl
mRatBN7.2 Ensembl	7	65,434,394 - 65,477,383 (+)	Ensembl
Rnor_6.0 Ensembl	7	72,924,799 - 72,968,101 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096255 ⟹ ENSRNOP00000079765

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	67,320,193 - 67,362,537 (+)	Ensembl
mRatBN7.2 Ensembl	7	65,434,997 - 65,477,383 (+)	Ensembl

RefSeq Acc Id:

NM_001013174 ⟹ NP_001013192

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	67,319,687 - 67,362,544 (+)	NCBI
mRatBN7.2	7	65,434,525 - 65,477,383 (+)	NCBI
Rnor_6.0	7	72,924,911 - 72,968,099 (+)	NCBI
Rnor_5.0	7	73,094,975 - 73,138,163 (+)	NCBI
RGSC_v3.4	7	69,654,990 - 69,697,852 (+)	RGD
Celera	7	62,539,514 - 62,582,361 (+)	RGD

Sequence:

show sequence

GCGGACCGTGTGAGCGGAGCCCGGGACGAAAAGAGAGAGACGGTCTCGCAAACTTGTGCGAGCG
CCTGAGCTATGAAGATGGTCGCGCCCTGGACTCGGTTCTATTCCCACAGCTGCTGCCTGTGCTG
CCATGTCCGCACCGGCACCATCCTGTTGGGCATCTGGTACCTGATCATCAATGCCGTGGTCCTG
TTGATCCTGCTGAGTGCCCTGGCCGATCCCGATCAGTATCACTTTTCAGGCTCTGAACTAGGAG
GGGAATTTGAGTTCATGGACGATGCCAACATGTGCATTGCTATCGCGATCTCTCTCCTCATGAT
CCTGATCTGTGCCATGGCTACCTACGGTGCATACAAGCAACACGCTGCCTGGATCATCCCGTTC
TTCTGTTACCAGATCTTTGATTTCGCCCTGAATACTTTGGTTGCAATCACCGTGCTTGTCTACC
CCAACTCCATTCAGGAGTACATAAGACAGCTGCCCCCCAGCTTTCCCTACAGAGATGACATAAT
GTCAGTGAACCCTACCTGTTTGGTCCTTGTCATCCTTCTCTTCATAGGCATTATTTTGACATTT
AAGGGCTACTTGATCAGCTGTGTTTGGAGCTGCTACAGGTACATCAATGGCAGGAACTCCTCTG
ATGTTCTGGTTTACGTTACCAGCAACGATACCACGGTGCTGTTGCCACCATACGATGATGCCAC
TGCTGTGACCGGCACTGCCAAGGAGCCACCGCCACCTTACGTGTCTGCCTGAACGTGGTGTGGA
GGAGCCCAGAGCGCCAGTCTGAGCCCACAGCTGCTTGATTGACCCTGTGGTTTCACCTCTCCTC
CGTGATGAGCTCTTTGAGCCTGTTTGTTGTTAAAATGCCATGTTTTAAAATTTAGATGTTAAGT
TGAAGCCTCTGTTGTCTGACGTACCCTGTACCCAAGCACCGAGTAGTAAGGCTGTAGGACTGTT
TTGGTAGGAGGGGGCTGTGATGAGTTCTCAGAGTCTTTCTCAAAACTATGTACGGCGTTCCCTG
GTCTGGTTTGTACCTGCCTGGCCCCAAAGCCAGGGGGCAGTCATACTTTTCCTCTCCATTCCTT
CTGACTGTTTGAAAGTACAAAATAAAAATTAGATCATACTTAAACTATTCCAGAATCCCTAATA
AAAACAATATTAATTGTTCTAATTATGTAGTTAGGAGCCCTTATATATGTGATATAAGAATTTC
CCTACTATCCCCAAGTTCAGTGATATTCTGAATTTGCTGGTCAAGAATTTTCTTTGGGCTAAAT
AAGGACTGTGAGGTAATAGGAACAGTGAGGGCAAGGGCTGCCCAGGATGTCTGTTTTGAGCTAG
GGCTGATGTGTCTCCCTGTGTGAAAGGGGGACCAGCTTGCTTGGCTCAGAAAAACTCAGACTCA
CTTTTCCTCAGCGTCCTCCAGCAAATACCTTGCTTTGTCAAGCAGAACCACCCGTGTACGTTTG
GGAAAAGGTGTTCACACTCTTTCCTTGCAAGGTACACCCTACTTTGAATTTCTAAGTATGCCTA
ATCATTTATTAAAGTGTCAAGCAGTCTTCAGAAAGATAAGGAGGCTCGTTCCCATGTGGAATGC
TCTAGATTGTCTGAATTGCAAACGATGTTTGTGTCCATGTCTCTGAATGTGAACAACTCTCCTG
CTTGTTCATTGCTCAGTGTGCTGTACATGAAGGCTTTGCAATTAAAGTTTGTCTGCATCCAAGA
AAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039079227 ⟹ XP_038935155

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	67,319,438 - 67,362,547 (+)	NCBI
mRatBN7.2	7	65,435,024 - 65,477,386 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001013192	(Get FASTA)	NCBI Sequence Viewer
	XP_038935155	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH86442	(Get FASTA)	NCBI Sequence Viewer
	EDM16427	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000008969
	ENSRNOP00000008969.4
	ENSRNOP00000079765
GenBank Protein	Q5U1W4	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001013192 ⟸ NM_001013174

- UniProtKB:

Q5U1W4 (UniProtKB/Swiss-Prot), A6HQZ5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MKMVAPWTRFYSHSCCLCCHVRTGTILLGIWYLIINAVVLLILLSALADPDQYHFSGSELGGEF
EFMDDANMCIAIAISLLMILICAMATYGAYKQHAAWIIPFFCYQIFDFALNTLVAITVLVYPNS
IQEYIRQLPPSFPYRDDIMSVNPTCLVLVILLFIGIILTFKGYLISCVWSCYRYINGRNSSDVL
VYVTSNDTTVLLPPYDDATAVTGTAKEPPPPYVSA

hide sequence

Ensembl Acc Id:

ENSRNOP00000008969 ⟸ ENSRNOT00000008969

RefSeq Acc Id:	XP_038935155 ⟸ XM_039079227
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZNQ3 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000079765 ⟸ ENSRNOT00000096255

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5U1W4-F1-model_v2	AlphaFold	Q5U1W4	1-227	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695280

Promoter ID:

EPDNEW_R5805

Type:

initiation region

Name:

Laptm4b_1

Description:

lysosomal protein transmembrane 4 beta

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	72,924,808 - 72,924,868	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311853	AgrOrtholog
BioCyc Gene	G2FUF-33688	BioCyc
Ensembl Genes	ENSRNOG00000006766	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000008969	ENTREZGENE
	ENSRNOT00000008969.7	UniProtKB/Swiss-Prot
	ENSRNOT00000096255	ENTREZGENE
IMAGE_CLONE	IMAGE:7303600	IMAGE-MGC_LOAD
InterPro	LAPTM4/5	UniProtKB/Swiss-Prot
	LAPTM_transporter	UniProtKB/Swiss-Prot
KEGG Report	rno:315047	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105539	IMAGE-MGC_LOAD
NCBI Gene	315047	ENTREZGENE
PANTHER	LYSOSOMAL-ASSOCIATED TRANSMEMBRANE PROTEIN	UniProtKB/Swiss-Prot
	PTHR12479:SF6	UniProtKB/Swiss-Prot
Pfam	Mtp	UniProtKB/Swiss-Prot
PhenoGen	Laptm4b	PhenoGen
RatGTEx	ENSRNOG00000006766	RatGTEx
UniProt	A0A8I5ZNQ3	ENTREZGENE, UniProtKB/TrEMBL
	A6HQZ5	ENTREZGENE, UniProtKB/TrEMBL
	LAP4B_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-11-11	Laptm4b	lysosomal protein transmembrane 4 beta	Laptm4b	lysosomal-associated protein transmembrane 4B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Laptm4b	lysosomal-associated protein transmembrane 4B	Laptm4b_predicted	lysosomal-associated protein transmembrane 4B (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Laptm4b_predicted	lysosomal-associated protein transmembrane 4B (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message