Advanced Search (OLGA)

Gene: Chmp1a (charged multivesicular body protein 1A) Rattus norvegicus

Analyze

Symbol:

Chmp1a

Name:

charged multivesicular body protein 1A

RGD ID:

1311083

Description:

Predicted to enable protein domain specific binding activity and protein homodimerization activity. Predicted to be involved in several processes, including midbody abscission; regulation of cell cycle process; and vacuolar transport. Predicted to act upstream of or within mitotic chromosome condensation and negative regulation of gene expression. Predicted to be located in several cellular components, including bounding membrane of organelle; microtubule cytoskeleton; and nuclear lumen. Predicted to be part of ESCRT III complex and nuclear pore. Predicted to be active in multivesicular body. Human ortholog(s) of this gene implicated in pontocerebellar hypoplasia type 8. Orthologous to human CHMP1A (charged multivesicular body protein 1A); PARTICIPATES IN endocytosis pathway; INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,4-dinitrotoluene; 2-methoxyethanol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

chromatin modifying protein 1A; LOC365024; Pcoln3; procollagen (type III) N-endopeptidase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CHMP1A (charged multivesicular body protein 1A)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Chmp1a (charged multivesicular body protein 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Chmp1a (charged multivesicular body protein 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CHMP1A (charged multivesicular body protein 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CHMP1A (charged multivesicular body protein 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Chmp1a (charged multivesicular body protein 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CHMP1A (charged multivesicular body protein 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CHMP1A (charged multivesicular body protein 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Chmp1a (charged multivesicular body protein 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Chmp1a (charged multivesicular body protein 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Chmp1a (charged multivesicular body protein 1A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	CHMP1A (charged multivesicular body protein 1A)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	chmp1a (charged multivesicular body protein 1A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	DID2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	DID2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	chmp1a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	chmp1a	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	68,146,672 - 68,154,952 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	68,146,672 - 68,154,952 (-)	Ensembl				GRCr8
mRatBN7.2	19	51,238,153 - 51,246,433 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	51,238,160 - 51,246,436 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	58,033,361 - 58,041,363 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	58,713,074 - 58,721,354 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	60,931,961 - 60,939,963 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	19	61,945,463 - 61,953,755 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	19	60,067,560 - 60,075,840 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	19	61,941,058 - 61,949,338 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	19	59,676,622 - 59,684,913 (-)	NCBI		F344_StmMcwi
Rnor_6.0	19	56,001,724 - 56,010,004 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	56,001,724 - 56,010,004 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	66,707,177 - 66,715,457 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	53,521,981 - 53,530,261 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	50,473,734 - 50,481,997 (-)	NCBI		Celera
RGSC_v3.1	19	53,529,029 - 53,531,632 (-)	NCBI
Cytogenetic Map	19	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

intellectual disability (ISO)

pontocerebellar hypoplasia (ISO)

pontocerebellar hypoplasia type 1A (ISO)

pontocerebellar hypoplasia type 1B (ISO)

pontocerebellar hypoplasia type 8 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

2-methoxyethanol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

acetylsalicylic acid (ISO)

actinomycin D (ISO)

Aflatoxin B2 alpha (ISO)

arsenous acid (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

bisphenol F (EXP,ISO)

butan-1-ol (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

elemental selenium (ISO)

enzyme inhibitor (ISO)

folic acid (ISO)

gentamycin (EXP)

glyphosate (ISO)

indometacin (ISO)

methapyrilene (ISO)

nickel sulfate (ISO)

nitrates (ISO)

Nutlin-3 (ISO)

paracetamol (ISO)

rotenone (ISO)

SB 431542 (ISO)

Se-methyl-L-selenocysteine (ISO)

Se-methylselenocysteine (ISO)

selenium atom (ISO)

sodium arsenite (ISO)

temozolomide (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

autophagosome maturation (IEA,ISO)

autophagy (IEA,ISO)

cell division (IEA,ISO)

endosome transport via multivesicular body sorting pathway (IBA)

late endosome to lysosome transport (IEA,ISO)

late endosome to vacuole transport (IBA)

midbody abscission (IEA,ISO)

mitotic chromosome condensation (ISO)

mitotic metaphase chromosome alignment (IEA,ISO)

multivesicular body sorting pathway (IEA,ISO)

negative regulation of gene expression (ISO)

nuclear membrane reassembly (IEA,ISO)

nucleus organization (IEA,ISO)

plasma membrane repair (IEA,ISO)

protein transport (IBA)

regulation of centrosome duplication (IEA,ISO)

regulation of mitotic spindle assembly (IEA,ISO)

ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway (IEA,ISO)

vacuolar transport (IEA)

vesicle-mediated transport (IEA,ISO)

viral budding from plasma membrane (IEA,ISO)

viral budding via host ESCRT complex (IEA,ISO)

Cellular Component

amphisome membrane (IEA,ISO)

autophagosome membrane (IEA,ISO)

condensed nuclear chromosome (IEA,ISO)

cytosol (IEA,ISO)

early endosome (IEA,ISO)

endomembrane system (IEA,ISO)

ESCRT III complex (IBA)

kinetochore (IEA,ISO)

kinetochore microtubule (IEA,ISO)

lysosomal membrane (IEA,ISO)

microtubule organizing center (IEA,ISO)

midbody (IEA,ISO)

multivesicular body (IBA)

multivesicular body membrane (IEA,ISO)

nuclear matrix (IEA,ISO)

nucleoplasm (IEA,ISO)

plasma membrane (IEA,ISO)

Molecular Function

identical protein binding (IEA,ISO)

protein binding (ISO)

protein domain specific binding (IEA,ISO)

protein homodimerization activity (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

endocytosis pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:8889548	PMID:9837962	PMID:11559747	PMID:11559748	PMID:14505570	PMID:14519844	PMID:16730941	PMID:17928862	PMID:18834074	PMID:19056867	PMID:19129479	PMID:20616062
PMID:23376485

Genomics

Comparative Map Data

Chmp1a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	68,146,672 - 68,154,952 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	68,146,672 - 68,154,952 (-)	Ensembl				GRCr8
mRatBN7.2	19	51,238,153 - 51,246,433 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	51,238,160 - 51,246,436 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	58,033,361 - 58,041,363 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	58,713,074 - 58,721,354 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	60,931,961 - 60,939,963 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	19	61,945,463 - 61,953,755 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	19	60,067,560 - 60,075,840 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	19	61,941,058 - 61,949,338 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	19	59,676,622 - 59,684,913 (-)	NCBI		F344_StmMcwi
Rnor_6.0	19	56,001,724 - 56,010,004 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	56,001,724 - 56,010,004 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	66,707,177 - 66,715,457 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	53,521,981 - 53,530,261 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	50,473,734 - 50,481,997 (-)	NCBI		Celera
RGSC_v3.1	19	53,529,029 - 53,531,632 (-)	NCBI
Cytogenetic Map	19	q12	NCBI

CHMP1A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	89,644,435 - 89,657,708 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	89,640,816 - 89,657,738 (-)	Ensembl			hg38	GRCh38
GRCh37	16	89,710,843 - 89,724,116 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	88,238,344 - 88,251,630 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	16	88,238,345 - 88,251,754	NCBI
Celera	16	74,775,335 - 74,788,601 (-)	NCBI		Celera
Cytogenetic Map	16	q24.3	NCBI
HuRef	16	75,406,208 - 75,419,708 (-)	NCBI		HuRef
CHM1_1	16	91,122,139 - 91,134,975 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	95,728,224 - 95,742,519 (-)	NCBI		T2T-CHM13v2.0

Chmp1a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	123,931,000 - 123,939,527 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	123,931,003 - 123,939,502 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	8	123,204,261 - 123,212,788 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	123,204,264 - 123,212,763 (-)	Ensembl			mm10	GRCm38
MGSCv37	8	125,728,161 - 125,736,688 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	8	126,090,354 - 126,098,828 (-)	NCBI		MGSCv36	mm8
Celera	8	127,435,808 - 127,451,781 (-)	NCBI		Celera
Cytogenetic Map	8	E1	NCBI
cM Map	8	72.08	NCBI

Chmp1a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955541	3,216,972 - 3,223,634 (-)	Ensembl
ChiLan1.0	NW_004955541	3,216,972 - 3,223,636 (-)	NCBI	ChiLan1.0	ChiLan1.0

CHMP1A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	99,434,669 - 99,448,095 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	105,348,049 - 105,361,467 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	70,398,021 - 70,411,383 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	90,003,892 - 90,017,653 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	90,003,892 - 90,017,653 (-)	Ensembl			panPan2	panpan1.1

CHMP1A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	63,897,544 - 63,906,515 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	63,897,594 - 63,905,550 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	63,910,397 - 63,919,629 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	64,125,390 - 64,134,623 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	64,125,425 - 64,134,621 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	64,145,452 - 64,154,671 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	63,983,044 - 63,992,276 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	64,389,618 - 64,398,851 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Chmp1a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	24,612,956 - 24,622,756 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936641	366,569 - 376,337 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936641	366,563 - 376,303 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CHMP1A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	351,866 - 358,653 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	351,878 - 358,655 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	478,538 - 485,468 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CHMP1A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	74,990,706 - 75,002,074 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	74,990,410 - 75,001,988 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666047	498,027 - 509,396 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Chmp1a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	302,404 - 309,644 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624746	302,344 - 309,117 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Chmp1a
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	17	42,809,699 - 42,817,381 (-)	NCBI		Rrattus_CSIRO_v1

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	429
Count of miRNA genes:	240
Interacting mature miRNAs:	281
Transcripts:	ENSRNOT00000021483
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
724546	Kidm3	Kidney mass QTL 3	3.1		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	19	46226778	74246245	Rat
631840	Niddm38	Non-insulin dependent diabetes mellitus QTL 38	3.86		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	19	10329076	74246245	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	32365311	74246245	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	24093973	69093973	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	36289	74246245	Rat
2303628	Vencon9	Ventilatory control QTL 9		0.005	respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	19	23188586	68188586	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10833618	74246245	Rat
2313395	Anxrr26	Anxiety related response QTL 26			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	19	44385134	74246245	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	32539615	74246245	Rat
5135224	Leukc1	Leukocyte quantity QTL 1			eosinophil quantity (VT:0002602)	blood eosinophil count (CMO:0000033)	19	61249161	74246245	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	31777888	74246245	Rat
1554318	Bmd5	Bone mineral density QTL 5	12.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	19	23188586	68188586	Rat
1549835	Tcas7	Tongue tumor susceptibility QTL 7		0.001	tongue integrity trait (VT:0010553)	squamous cell carcinoma of the head and neck tumor number (CMO:0001876)	19	41722546	74246245	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2194317	74246245	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2194317	74246245	Rat

Markers in Region

RH128055

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	51,238,262 - 51,238,458 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	56,001,834 - 56,002,029	NCBI	Rnor6.0
Rnor_5.0	19	66,707,287 - 66,707,482	UniSTS	Rnor5.0
RGSC_v3.4	19	53,522,091 - 53,522,286	UniSTS	RGSC3.4
Celera	19	50,473,844 - 50,474,039	UniSTS
RH 3.4 Map	19	710.21	UniSTS
Cytogenetic Map	19	q12	UniSTS

RH131695

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	51,237,653 - 51,237,870 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	56,001,225 - 56,001,441	NCBI	Rnor6.0
Rnor_5.0	19	66,706,678 - 66,706,894	UniSTS	Rnor5.0
RGSC_v3.4	19	53,521,482 - 53,521,698	UniSTS	RGSC3.4
Celera	19	50,473,235 - 50,473,451	UniSTS
RH 3.4 Map	19	708.21	UniSTS
Cytogenetic Map	19	q12	UniSTS

BE110224

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	51,244,824 - 51,244,990 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	56,008,396 - 56,008,561	NCBI	Rnor6.0
Rnor_5.0	19	66,713,849 - 66,714,014	UniSTS	Rnor5.0
RGSC_v3.4	19	53,528,653 - 53,528,818	UniSTS	RGSC3.4
RH 3.4 Map	19	710.81	UniSTS
Cytogenetic Map	19	q12	UniSTS

AI102036

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	51,238,712 - 51,238,832 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	56,002,284 - 56,002,403	NCBI	Rnor6.0
Rnor_5.0	19	66,707,737 - 66,707,856	UniSTS	Rnor5.0
RGSC_v3.4	19	53,522,541 - 53,522,660	UniSTS	RGSC3.4
Celera	19	50,474,294 - 50,474,413	UniSTS
RH 3.4 Map	19	713.41	UniSTS
Cytogenetic Map	19	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001083313	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC119635	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BM386466	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB691666	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CK358527	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CO559393	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CX570446	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000021483 ⟹ ENSRNOP00000021475

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	68,146,672 - 68,154,952 (-)	Ensembl
mRatBN7.2 Ensembl	19	51,238,170 - 51,246,436 (-)	Ensembl
Rnor_6.0 Ensembl	19	56,001,724 - 56,010,004 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000115232 ⟹ ENSRNOP00000094810

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	68,146,672 - 68,151,575 (-)	Ensembl
mRatBN7.2 Ensembl	19	51,238,160 - 51,243,056 (-)	Ensembl

RefSeq Acc Id:

NM_001083313 ⟹ NP_001076782

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	68,146,672 - 68,154,952 (-)	NCBI
mRatBN7.2	19	51,238,153 - 51,246,433 (-)	NCBI
Dahl_SR_JrHsd	19	61,945,463 - 61,953,755 (-)	NCBI
Lyon_Normotensive	19	60,067,560 - 60,075,840 (-)	NCBI
Lyon_Hypertensive	19	61,941,058 - 61,949,338 (-)	NCBI
F344_StmMcwi	19	59,676,622 - 59,684,913 (-)	NCBI
Rnor_6.0	19	56,001,724 - 56,010,004 (-)	NCBI
Rnor_5.0	19	66,707,177 - 66,715,457 (-)	NCBI
RGSC_v3.4	19	53,521,981 - 53,530,261 (-)	RGD
Celera	19	50,473,734 - 50,481,997 (-)	RGD

Sequence:

show sequence

CTCACGGCTACAGCTAGTCCGGAAGGTCTCCGTACCCTGCGCCGCCCTGAGGGGTGTGCTGTCC
GACTGGCCATGGACGATACCCTGTTCCAGTTGAAGTTCACAGCAAAGCAGCTGGAGAAACTAGC
CAAGAAGGCAGAGAAGGACTCCAAGGCTGAGCAGGCCAAAGTGAAGAAGGCCCTTCAGCAGAAA
AATGTGGAGTGTGCCCGTGTGTATGCTGAAAACGCCATCCGCAAGAAGAATGAAGGCGTAAACT
GGCTCCGGATGGCATCCCGTGTGGACGCAGTGGCCTCCAAGGTGCAGACAGCTGTGACCATGAA
GGGGGTGACCAAGAACATGGCTCAGGTGACCAAAGCTCTGGACAAGGCCCTGAGTGCCATGGAC
CTTCAGAAGGTGTCTGCAGTGATGGACAGGTTTGAGCAGCAGGTGCAGAACCTGGATGTGCACA
CATCGGTGATGGAGGATTCTGTGAGCTCTGCCACTACACTGACCACACCTCAGGAGCAGGTCGA
CAGCCTCATCGTTCAGATTGCTGAGGAGAATGGCCTGGAGGTCCTTGACCAACTCAGCCAGCTT
CCGGAGGGAGCCTCTGCCGTGGGCGAAAGCTCTGTGCGCAGCCAAGAGGACCAACTGTCTCGGA
GGTTGGCTGCCCTGAGGAATTAGCACGTTGTTGGCAGGTGCTGCCTCCATCGCCCTGAGATGTC
CTGGAGGCTTCCGCCCGGCTGCACTCCACTTCCTCCAACCCTTCATAGCTGCCTTGCCTTTCCC
AACCTGTCAGGCTGGCGCCTTAGGACATCAGGCAGCGAGTCTCTGTCCTGGCATTGAATTTGCA
CAAGTGTGTGGTGACTTATGTGAGTGTAGGCCACAGCTGGAGGATGGCAAGCTCTCTTTTGTCC
TTTGCCTATGTGGAGTTGACAGGGTTTGACCTGCAGATGTGTGTGGACTTCAGCCCAGTGCTTT
GGGGCCTTCGGATTCCAGCGACCGCACACCTGCTATGTGCTGTGGCCAGCGAGGGTCAGAGCTA
TCCCTCCTTTGCCAGGCAACTCTTGGGAGCCTCTCCCCCTCCTCTGCAGACAGGAAATCCCATT
GTGTGAGAGCCCTTAGTAGGTTCCTGTGAACTTTGTGTACCAAGGTGTCCAGTGCCACTGACAC
TGACCTGGGGCCTTTACAAATGGTAACTCTCCTCCATCTTCCCAGGGCTGCAGGCTTGGCGTCC
ACTGCCGGCTTGGGCTTTCGTCCCTCAGCTCTCTTTCCCAGCCCACAGGAACAGAACTGCCATC
CAATTTCAAGTCCAGGTCCTTCCTAAGAGATTCTTAAACTGAATTCTGCAGCTGCCTCTGGAAG
AACTCTGGCCCCTGGAGCTGAGCTTGTCTGCCTCATGCTGACCGGCCCTCTGCCGTCAGCCTCC
CAGGCCTTTTTAGAGCGGCTCATTCCTGATTGTCTGGCTCTCCTGTCCTTTTAGACAAAGGCTG
CTGCTTTCTGCCTTCTCCAAGGGAGAGTCACGGTGGCTAACAAAGGGAGCCTGAGTCAGTCACT
CTGGCTGCTGGCAGCAAACGCTTACATCCTTCCGCAGTGAGGAAGCTGGCGGCAAGCAGGCAGT
GCGGCTGACTGGGCAGCCTTGAGACTCTGTACAGGCTGCTGTTTTATTTTTCTGTCTCCTGAAG
TTTACTCATGTTCTTAAAACTCCTGGTGATTTTGTTCTTTTGCCAAAGTAGTAAGCACAGTGGA
GGGGTGTGTTCATCCCAGCCCTCTGTAGGCTGAGCAGTGCCGCTGCCCACAGGTTTGCACGCCT
TGGAGACAACCTGTGTTTGGCTGCTTCTGTTCTGCACTTGCAGCCCCTGGGTACCCCATATTAC
ACGTTGGTGTTAAAGGCAGGGGCTGGAATTGTTGGTCCTGGATGTGGGGACCAAGGTACAATCT
AACCATGGGCCCCTGCAAGGCTTCCTGAAATCAACTTACAGGTTAGGTGTAGTTCCCTGGGTCC
TAGAGGGTGCAGGATTTGTAGGGATGGGGAAGCTGGGCTGGGTTCATCAAAATGGGCATATCTG
CCTTTAGAATGTTGTCGTAAGTAAATAAAGGGATTGGTGGAGAACGTCAAAAAAAAAAAAAAAA
AA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001076782	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL92790	(Get FASTA)	NCBI Sequence Viewer
	EDL92791	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000021475
	ENSRNOP00000021475.5
	ENSRNOP00000094810.1

RefSeq Acc Id:	NP_001076782 ⟸ NM_001083313
- UniProtKB:	D4AE79 (UniProtKB/TrEMBL)
- Sequence:	show sequence MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALQQKNVECARVYAENAIRKKNEGVNWLR MASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSAMDLQKVSAVMDRFEQQVQNLDVHTSV MEDSVSSATTLTTPQEQVDSLIVQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLA ALRN hide sequence

Ensembl Acc Id:

ENSRNOP00000021475 ⟸ ENSRNOT00000021483

Ensembl Acc Id:

ENSRNOP00000094810 ⟸ ENSRNOT00000115232

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4AE79-F1-model_v2	AlphaFold	D4AE79	1-196	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701219

Promoter ID:

EPDNEW_R11743

Type:

initiation region

Name:

Chmp1a_1

Description:

charged multivesicular body protein 1A

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	19	56,009,989 - 56,010,049	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311083	AgrOrtholog
BioCyc Gene	G2FUF-5337	BioCyc
Ensembl Genes	ENSRNOG00000016001	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000021483	ENTREZGENE
	ENSRNOT00000021483.6	UniProtKB/TrEMBL
	ENSRNOT00000115232.2	UniProtKB/TrEMBL
Gene3D-CATH	6.10.140.1230	UniProtKB/TrEMBL
InterPro	Snf7	UniProtKB/TrEMBL
NCBI Gene	365024	ENTREZGENE
PANTHER	PTHR10476	UniProtKB/TrEMBL
Pfam	Snf7	UniProtKB/TrEMBL
PhenoGen	Chmp1a	PhenoGen
RatGTEx	ENSRNOG00000016001	RatGTEx
UniProt	A0A8I6GLB8_RAT	UniProtKB/TrEMBL
	D4AE79	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-12-06	Chmp1a	charged multivesicular body protein 1A	Chmp1a	chromatin modifying protein 1A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2007-03-22	Chmp1a	chromatin modifying protein 1A	Pcoln3_predicted	procollagen (type III) N-endopeptidase (predicted)	Symbol and Name updated to reflect Human and Mouse nomenclature	1299863	APPROVED
2005-01-12	Pcoln3_predicted	procollagen (type III) N-endopeptidase (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)