Advanced Search (OLGA)

Gene: Ptgir (prostaglandin I2 receptor) Rattus norvegicus

Analyze

Symbol:

Ptgir

Name:

prostaglandin I2 receptor

RGD ID:

1310890

Description:

Predicted to enable prostacyclin receptor activity. Predicted to be involved in several processes, including adenylate cyclase-activating G protein-coupled receptor signaling pathway; negative regulation of platelet-derived growth factor receptor signaling pathway; and negative regulation of smooth muscle cell proliferation. Predicted to act upstream of or within response to lipopolysaccharide. Predicted to be located in cytosol. Predicted to be active in plasma membrane. Orthologous to human PTGIR (prostaglandin I2 receptor); PARTICIPATES IN eicosanoid signaling pathway; prostaglandin I2 signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrobenzenesulfonic acid; ammonium chloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC292661; PGI receptor; PGI2 receptor; prostacyclin receptor; prostaglandin I receptor (IP); prostaglandin I2 (prostacyclin) receptor; prostaglandin I2 (prostacyclin) receptor (IP); prostanoid IP receptor

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PTGIR (prostaglandin I2 receptor)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ptgir (prostaglandin I receptor (IP))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ptgir (prostaglandin I2 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PTGIR (prostaglandin I2 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PTGIR (prostaglandin I2 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ptgir (prostaglandin I2 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PTGIR (prostaglandin I2 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PTGIR (prostaglandin I2 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ptgir (prostaglandin I2 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ptgir (prostaglandin I2 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RFLNB (refilin B)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	PTGIR (prostaglandin I2 receptor)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ptgir (prostaglandin I receptor (IP))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ptgir (prostaglandin I2 receptor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG7497	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG7497	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ptgir	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ptgir	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	86,707,690 - 86,710,073 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	86,707,503 - 86,711,874 (+)	Ensembl				GRCr8
mRatBN7.2	1	77,579,596 - 77,581,979 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	77,579,596 - 77,581,979 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	82,959,574 - 82,961,958 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	91,523,619 - 91,526,003 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	84,714,664 - 84,717,048 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	78,833,449 - 78,835,832 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	78,833,157 - 78,837,623 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	80,080,854 - 80,083,237 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	77,234,538 - 77,236,921 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	72,064,851 - 72,067,234 (+)	NCBI		Celera
RGSC_v3.1	1	77,312,476 - 77,315,005 (+)	NCBI
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

aspirin-induced respiratory disease (ISO)

heart disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4,6-trinitrobenzenesulfonic acid (EXP)

3',5'-cyclic AMP (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

acetylsalicylic acid (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

asbestos (ISO)

Azoxymethane (ISO)

benzo[a]pyrene (ISO)

beraprost (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

buta-1,3-diene (ISO)

butanal (ISO)

Butylbenzyl phthalate (ISO)

calcium atom (ISO)

calcium(0) (ISO)

cannabidiol (ISO)

capsaicin (ISO)

Carbaprostacyclin (ISO)

carbon nanotube (ISO)

chloroprene (ISO)

choline (ISO)

cicaprost (ISO)

clofibrate (EXP)

Cuprizon (EXP)

dexamethasone (ISO)

dextran sulfate (ISO)

Dibutyl phosphate (ISO)

dioxygen (ISO)

doxorubicin (ISO)

endosulfan (EXP)

folic acid (ISO)

gentamycin (EXP)

hypochlorous acid (ISO)

iloprost (ISO)

indometacin (ISO)

L-methionine (ISO)

lipopolysaccharide (ISO)

mevalonolactone (ISO)

mifepristone (ISO)

N-methyl-4-phenylpyridinium (ISO)

nickel atom (ISO)

Nor-9-carboxy-delta9-THC (ISO)

paracetamol (EXP,ISO)

pentanal (ISO)

phenylarsine oxide (ISO)

propanal (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sotorasib (ISO)

succimer (ISO)

Theaflavin 3,3'-digallate (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trametinib (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-activating G protein-coupled receptor signaling pathway (IBA,IEA,ISO)

G protein-coupled receptor signaling pathway (IEA)

inflammatory response (IBA)

negative regulation of platelet-derived growth factor receptor signaling pathway (IEA,ISO)

negative regulation of smooth muscle cell proliferation (IBA,IEA,ISO)

positive regulation of cytosolic calcium ion concentration (IBA)

response to lipopolysaccharide (ISO)

signal transduction (IEA)

Cellular Component

cytosol (IEA,ISO)

membrane (IEA)

plasma membrane (IBA,IEA,ISO)

Molecular Function

G protein-coupled receptor activity (IEA)

prostacyclin receptor activity (IBA)

prostanoid receptor activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

eicosanoid signaling pathway (ISO)

prostaglandin I2 signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
5.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:7803522	PMID:15834430	PMID:19696359	PMID:20622039	PMID:20622163	PMID:21549696	PMID:21749934

Genomics

Comparative Map Data

Ptgir
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	86,707,690 - 86,710,073 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	86,707,503 - 86,711,874 (+)	Ensembl				GRCr8
mRatBN7.2	1	77,579,596 - 77,581,979 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	77,579,596 - 77,581,979 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	82,959,574 - 82,961,958 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	91,523,619 - 91,526,003 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	84,714,664 - 84,717,048 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	78,833,449 - 78,835,832 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	78,833,157 - 78,837,623 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	80,080,854 - 80,083,237 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	77,234,538 - 77,236,921 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	72,064,851 - 72,067,234 (+)	NCBI		Celera
RGSC_v3.1	1	77,312,476 - 77,315,005 (+)	NCBI
Cytogenetic Map	1	q21	NCBI

PTGIR
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	46,610,687 - 46,625,089 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	46,618,550 - 46,625,534 (-)	Ensembl			hg38	GRCh38
GRCh37	19	47,123,725 - 47,128,346 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	51,815,565 - 51,820,194 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	51,815,565 - 51,820,194	NCBI
Celera	19	43,927,252 - 43,931,881 (-)	NCBI		Celera
Cytogenetic Map	19	q13.32	NCBI
HuRef	19	43,548,741 - 43,553,370 (-)	NCBI		HuRef
CHM1_1	19	47,125,572 - 47,130,201 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	49,436,301 - 49,450,683 (-)	NCBI		T2T-CHM13v2.0

Ptgir
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	16,640,442 - 16,644,828 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	16,640,415 - 16,644,830 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	16,906,490 - 16,910,905 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	16,906,490 - 16,910,905 (+)	Ensembl			mm10	GRCm38
MGSCv37	7	17,491,839 - 17,496,254 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	16,065,012 - 16,069,427 (+)	NCBI		MGSCv36	mm8
Celera	7	14,112,908 - 14,117,323 (+)	NCBI		Celera
Cytogenetic Map	7	A2	NCBI
cM Map	7	9.15	NCBI

Ptgir
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955574	687,583 - 689,750 (-)	Ensembl
ChiLan1.0	NW_004955574	686,156 - 690,126 (-)	NCBI	ChiLan1.0	ChiLan1.0

PTGIR
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	52,770,490 - 52,775,153 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	54,641,304 - 54,645,928 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	43,613,065 - 43,617,700 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	52,141,822 - 52,146,473 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	52,141,822 - 52,146,473 (-)	Ensembl			panPan2	panpan1.1

PTGIR
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	109,275,198 - 109,279,463 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	109,274,988 - 109,277,584 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	108,754,493 - 108,758,755 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	109,801,203 - 109,805,465 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	109,801,007 - 109,805,132 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	109,478,359 - 109,480,898 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	109,112,477 - 109,116,738 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	109,981,209 - 109,985,471 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ptgir
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	18,866,264 - 18,871,516 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936664	487,125 - 489,414 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936664	487,069 - 489,328 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PTGIR
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	52,522,638 - 52,527,345 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	52,522,639 - 52,527,338 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	47,842,083 - 47,847,155 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PTGIR
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	39,977,057 - 39,983,592 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	39,977,864 - 39,980,860 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666073	19,689,063 - 19,693,721 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ptgir
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624832	6,948,572 - 6,952,719 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624832	6,948,638 - 6,952,664 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ptgir
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	172,182,700 - 172,185,077 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ptgir
14 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	110
Count of miRNA genes:	94
Interacting mature miRNAs:	102
Transcripts:	ENSRNOT00000022461
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331732	Srn4	Serum renin concentration QTL 4	4.467		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	1	43457837	87558729	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	51940904	101229020	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	39728272	132889942	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	46302615	91302615	Rat
1331792	Rf29	Renal function QTL 29	4.589		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	1	43457837	87558729	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	46302615	91302615	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	43509952	88509952	Rat
1354643	Foco2	Food consumption QTL 2	7.17	0.0001	eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	1	42122968	87122968	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	83019780	128019780	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	66404680	111404680	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	46302615	91302615	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	81269860	99645535	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
1331778	Rf28	Renal function QTL 28	4.66		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	1	43457837	87558729	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	46302615	91302615	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	66400974	132889942	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	84107164	115183752	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	30708375	87558729	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	65405637	96805205	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	51909206	91302615	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	86622262	131622262	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	58769992	103769992	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	66077886	111077886	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	46302615	91302615	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	43509952	88509952	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	52891222	109116986	Rat
1354599	Bw29	Body weight QTL 29	3.46	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	42122968	87122968	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	46302615	91302615	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	43509952	88509952	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
12	11	67	159	91	90	59	89	59	6	334	187	8	136	68	89	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001077644	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC127887	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D28966	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000022461 ⟹ ENSRNOP00000022461

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	86,707,503 - 86,711,874 (+)	Ensembl
mRatBN7.2 Ensembl	1	77,579,596 - 77,581,979 (+)	Ensembl
Rnor_6.0 Ensembl	1	78,833,157 - 78,837,623 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000100532 ⟹ ENSRNOP00000089168

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	77,579,678 - 77,581,979 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000133939 ⟹ ENSRNOP00000111232

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	86,707,573 - 86,711,874 (+)	Ensembl

RefSeq Acc Id:

NM_001077644 ⟹ NP_001071112

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	86,707,690 - 86,710,073 (+)	NCBI
mRatBN7.2	1	77,579,596 - 77,581,979 (+)	NCBI
Rnor_6.0	1	78,833,449 - 78,835,832 (+)	NCBI
Rnor_5.0	1	80,080,854 - 80,083,237 (+)	NCBI
RGSC_v3.4	1	77,234,538 - 77,236,921 (+)	RGD
Celera	1	72,064,851 - 72,067,234 (+)	RGD

Sequence:

show sequence

CTGGAGAAGACGGAAACAAAAGACAGAAACACACGCACACGGGGAACTGGGAGTTGACTGGCAG
ATCCCAGCTGCCCTGAGGATGGTGGCCAGCGGTGGACGTCCTGATGGTCCCCCTTCTATCACCC
CCGAGAGCCCTCTCATTGTAGGTGGCAGAGAGTGGCAGGGTATGGCAGGTTCTTGCTGGAACAT
CACCTACGTTCAAGACTCGGTAGGACCTGCCACCAGCACCCTGATGTTTGTGGCTGGTGTGGTG
GGCAACGGGCTAGCACTGGGCATCCTGGGTGCCCGACGGAGGTCACACCCATCGGCGTTTGCAG
TGTTGGTCACTGGGCTGGCAGTGACGGATCTGCTGGGCACGTGCTTCTTGAGCCCCGCGGTGTT
TGTGGCCTATGCTCGAAACAGCTCTTTGCTGGGCCTGGCCCACGGTGGGACGATGCTGTGTGAC
ACTTTCGCCTTCGCTATGACTTTCTTCGGCCTGGCCTCCACGCTCATCCTCTTCGCCATGGCTG
TGGAGCGGTGCCTGGCTCTCAGTCATCCCTACCTGTACGCCCAGCTGGACGGGCCCCGCTGTGC
CCGCTTGGCTTTGCCTGCCATCTACGCTTTCTGTTGTCTCTTCTGCTCACTGCCCCTGCTGGGC
CTGGGCGAGCACCAGCAGTATTGTCCCGGGAGCTGGTGCTTCATCCGCATGCGTTCCCCCCAGC
CTGGTGGCTGTGCCTTCTCCCTGGCCTATGCCAGTCTCATGGCCCTGCTGGTGACCTCCATCTT
CTTCTGCAACGGCTCCGTCACTCTCAGCCTCTGTCACATGTACCGCCAACAGAGACGGCACCAT
GGCTCGTTTGTGCCGACCTCTCGGGCACGAGAGGATGAAGTTTACCACCTGATTCTGCTGGCCC
TCATGACAGGCATCATGGCCGTATGCTCCCTGCCTCTCACGATCAGAGGATTCACGCAGGCCAT
CGCCCCAGACAGCAGAGAGATGGGGGACCTCCACGCCTTCCGTTTTAATGCCTTCAACCCCATC
CTGGACCCCTGGGTCTTCATCCTTTTCCGAAAGGCTGTCTTCCAACGCCTCAAGTTCTGGTTGT
GTTGTCTGTGTGCCCGTTCTGTCCATGGGGATCTGCAGACGCCCCTCTCCCGGCCCGTGTCGGG
GAGAAGAGACACACTGGCTCCCGATTCTCTCCAGGCTAAGGAAGGGAACTGGGTGCCCCTGTCA
ACCTGGGGTACGGGGCAGGTGGCACCATTGACTGCTGTGCCTCTGTCTGGTGGTGATGGCTGTT
CTGTGGGAATGCCATCCAAAACAGAGGCTGTGGTTGCCTGCTCCCTCTGCTGATACCTAAGCTG
GTCCTGCTTGCCATCC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001071112	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAA06091	(Get FASTA)	NCBI Sequence Viewer
	EDM08294	(Get FASTA)	NCBI Sequence Viewer
	EDM08295	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000022461
	ENSRNOP00000022461.2
GenBank Protein	P43253	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001071112 ⟸ NM_001077644

- UniProtKB:

P43253 (UniProtKB/Swiss-Prot), A6J8D9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVASGGRPDGPPSITPESPLIVGGREWQGMAGSCWNITYVQDSVGPATSTLMFVAGVVGNGLAL
GILGARRRSHPSAFAVLVTGLAVTDLLGTCFLSPAVFVAYARNSSLLGLAHGGTMLCDTFAFAM
TFFGLASTLILFAMAVERCLALSHPYLYAQLDGPRCARLALPAIYAFCCLFCSLPLLGLGEHQQ
YCPGSWCFIRMRSPQPGGCAFSLAYASLMALLVTSIFFCNGSVTLSLCHMYRQQRRHHGSFVPT
SRAREDEVYHLILLALMTGIMAVCSLPLTIRGFTQAIAPDSREMGDLHAFRFNAFNPILDPWVF
ILFRKAVFQRLKFWLCCLCARSVHGDLQTPLSRPVSGRRDTLAPDSLQAKEGNWVPLSTWGTGQ
VAPLTAVPLSGGDGCSVGMPSKTEAVVACSLC

hide sequence

Ensembl Acc Id:

ENSRNOP00000022461 ⟸ ENSRNOT00000022461

Ensembl Acc Id:

ENSRNOP00000089168 ⟸ ENSRNOT00000100532

Ensembl Acc Id:

ENSRNOP00000111232 ⟸ ENSRNOT00000133939

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P43253-F1-model_v2	AlphaFold	P43253	1-416	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689744

Promoter ID:

EPDNEW_R268

Type:

initiation region

Name:

Ptgir_1

Description:

prostaglandin I2 receptor

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	78,833,234 - 78,833,294	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310890	AgrOrtholog
BioCyc Gene	G2FUF-60588	BioCyc
Ensembl Genes	ENSRNOG00000016756	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000022461	ENTREZGENE
	ENSRNOT00000022461.4	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
	Prostanoid_rcpt	UniProtKB/Swiss-Prot
	Prostglndn_IP_rcpt	UniProtKB/Swiss-Prot
KEGG Report	rno:292661	UniProtKB/Swiss-Prot
NCBI Gene	292661	ENTREZGENE
PANTHER	PTHR11866	UniProtKB/Swiss-Prot
	PTHR11866:SF7	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
PhenoGen	Ptgir	PhenoGen
PRINTS	PROSTANOIDR	UniProtKB/Swiss-Prot
	PRSTNOIDIPR	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000016756	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
UniProt	A0ABK0LZR8_RAT	UniProtKB/TrEMBL
	A6J8D9	ENTREZGENE, UniProtKB/TrEMBL
	P43253	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-08-22	Ptgir	prostaglandin I2 receptor	Ptgir	prostaglandin I2 (prostacyclin) receptor (IP)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-04-23	Ptgir	prostaglandin I2 (prostacyclin) receptor (IP)	Ptgir	prostaglandin I2 (prostacyclin) receptor	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-12-15	Ptgir	prostaglandin I2 (prostacyclin) receptor	Ptgir	prostaglandin I receptor (IP)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Ptgir	prostaglandin I receptor (IP)	Ptgir_predicted	prostaglandin I receptor (IP) (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Ptgir_predicted	prostaglandin I receptor (IP) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - PID (archival)