Advanced Search (OLGA)

Gene: Sox14 (SRY-box transcription factor 14) Rattus norvegicus

Analyze

Symbol:

Sox14

Name:

SRY-box transcription factor 14

RGD ID:

1309654

Description:

Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific; RNA polymerase II cis-regulatory region sequence-specific DNA binding activity; and chromatin binding activity. Predicted to be involved in nervous system development and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within entrainment of circadian clock; regulation of neuron migration; and visual perception. Predicted to be part of transcription regulator complex. Predicted to be active in nucleus. Orthologous to human SOX14 (SRY-box transcription factor 14); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; bis(2-ethylhexyl) phthalate.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC300954; SRY (sex determining region Y)-box 14; SRY box 14; SRY-box containing gene 14; transcription factor SOX-14

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SOX14 (SRY-box transcription factor 14)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Sox14 (SRY (sex determining region Y)-box 14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Sox14 (SRY-box transcription factor 14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SOX14 (SRY-box transcription factor 14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SOX14 (SRY-box transcription factor 14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Sox14 (SRY-box transcription factor 14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SOX14 (SRY-box transcription factor 14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SOX14 (SRY-box transcription factor 14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Sox14 (SRY-box transcription factor 14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Sox14 (SRY-box transcription factor 14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	SOX14 (SRY-box transcription factor 14)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Sox14 (SRY (sex determining region Y)-box 14)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	sox14 (SRY (sex determining region Y)-box 14)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Sox21a	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	Sox21a	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	sox-3	Alliance	DIOPT (OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	sox-3	Alliance	DIOPT (OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	sox-4	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	sox14	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	109,301,290 - 109,303,226 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	109,301,290 - 109,303,226 (-)	Ensembl				GRCr8
mRatBN7.2	8	100,421,982 - 100,423,918 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	100,421,982 - 100,423,918 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	106,091,601 - 106,093,537 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	104,290,904 - 104,292,840 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	102,133,443 - 102,135,379 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	8	110,212,617 - 110,214,553 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	8	112,317,394 - 112,319,330 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	8	110,806,674 - 110,808,610 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	8	102,216,004 - 102,217,941 (-)	NCBI		F344_StmMcwi
Rnor_6.0	8	108,107,865 - 108,109,801 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	108,107,865 - 108,109,801 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	107,531,635 - 107,533,571 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	104,736,946 - 104,738,882 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	99,822,896 - 99,824,832 (-)	NCBI		Celera
RGSC_v3.1	8	104,756,391 - 104,758,512 (-)	NCBI
Cytogenetic Map	8	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

syndromic microphthalmia 5 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dimethylhydrazine (ISO)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4,4'-trichlorobiphenyl (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

CGP 52608 (ISO)

copper atom (EXP)

copper(0) (EXP)

decabromodiphenyl ether (EXP)

deguelin (ISO)

dibutyl phthalate (EXP)

PCB138 (ISO)

resveratrol (ISO)

titanium dioxide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

brain development (IBA)

DNA-templated transcription (IEA)

entrainment of circadian clock (ISO)

negative regulation of transcription by RNA polymerase II (IBA)

neuron differentiation (IBA)

positive regulation of transcription by RNA polymerase II (IBA)

regulation of DNA-templated transcription (IEA)

regulation of neuron migration (ISO)

visual perception (ISO)

Cellular Component

nucleus (IBA,IEA)

transcription regulator complex (IEA,ISO)

Molecular Function

chromatin binding (IEA,ISO)

DNA binding (IEA)

DNA-binding transcription activator activity, RNA polymerase II-specific (IBA)

DNA-binding transcription factor activity, RNA polymerase II-specific (IEA,ISO)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA)

sequence-specific double-stranded DNA binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:22344693	PMID:22920256	PMID:24105743

Genomics

Comparative Map Data

Sox14
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	109,301,290 - 109,303,226 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	109,301,290 - 109,303,226 (-)	Ensembl				GRCr8
mRatBN7.2	8	100,421,982 - 100,423,918 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	100,421,982 - 100,423,918 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	106,091,601 - 106,093,537 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	104,290,904 - 104,292,840 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	102,133,443 - 102,135,379 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	8	110,212,617 - 110,214,553 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	8	112,317,394 - 112,319,330 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	8	110,806,674 - 110,808,610 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	8	102,216,004 - 102,217,941 (-)	NCBI		F344_StmMcwi
Rnor_6.0	8	108,107,865 - 108,109,801 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	108,107,865 - 108,109,801 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	107,531,635 - 107,533,571 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	104,736,946 - 104,738,882 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	99,822,896 - 99,824,832 (-)	NCBI		Celera
RGSC_v3.1	8	104,756,391 - 104,758,512 (-)	NCBI
Cytogenetic Map	8	q31	NCBI

SOX14
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	137,764,315 - 137,766,334 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	137,764,315 - 137,766,334 (+)	Ensembl			hg38	GRCh38
GRCh37	3	137,483,157 - 137,485,176 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	138,966,269 - 138,967,086 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	3	138,966,276 - 138,967,094	NCBI
Celera	3	135,908,242 - 135,909,059 (+)	NCBI		Celera
Cytogenetic Map	3	q22.3	NCBI
HuRef	3	134,857,756 - 134,859,798 (+)	NCBI		HuRef
CHM1_1	3	137,446,570 - 137,448,612 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	140,504,920 - 140,506,939 (+)	NCBI		T2T-CHM13v2.0

Sox14
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	99,756,159 - 99,758,223 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	99,756,159 - 99,758,223 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	9	99,874,106 - 99,876,170 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	99,874,106 - 99,876,170 (-)	Ensembl			mm10	GRCm38
MGSCv37	9	99,774,525 - 99,776,589 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	9	99,683,458 - 99,685,588 (-)	NCBI		MGSCv36	mm8
Celera	9	99,403,683 - 99,405,756 (-)	NCBI		Celera
Cytogenetic Map	9	E3.3	NCBI
cM Map	9	52.11	NCBI

Sox14
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955501	1,156,670 - 1,157,392 (-)	Ensembl
ChiLan1.0	NW_004955501	1,155,920 - 1,157,870 (-)	NCBI	ChiLan1.0	ChiLan1.0

SOX14
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	135,669,985 - 135,672,004 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	135,674,714 - 135,676,733 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	134,792,491 - 134,794,370 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	142,244,595 - 142,246,625 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	142,245,082 - 142,245,804 (+)	Ensembl			panPan2	panpan1.1

SOX14
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	23	34,079,534 - 34,081,598 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	23	34,080,037 - 34,080,759 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	23	34,064,692 - 34,065,552 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	23	34,611,946 - 34,612,806 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	23	34,611,946 - 34,612,668 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	23	34,293,518 - 34,294,378 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	23	34,359,188 - 34,360,048 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	23	34,610,280 - 34,611,140 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Sox14
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	73,420,806 - 73,422,895 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936540	161,124 - 161,846 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936540	160,638 - 162,662 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SOX14
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	78,620,984 - 78,622,577 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	78,620,818 - 78,621,702 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	86,232,861 - 86,234,959 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SOX14
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	52,749,639 - 52,766,770 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	52,762,326 - 52,763,045 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666041	25,783,693 - 25,785,738 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sox14
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	14,278,020 - 14,279,496 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624730	14,278,017 - 14,279,929 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Sox14
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	8	91,200,695 - 91,202,811 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Sox14
2 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	90
Count of miRNA genes:	80
Interacting mature miRNAs:	87
Transcripts:	ENSRNOT00000034277
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	105462581	132782436	Rat
1549909	Stresp11	Stress response QTL 11	6.83	0.0019	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	8	82352698	127352698	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	61019838	121662124	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	49849908	118871671	Rat
9590292	Uminl3	Urine mineral level QTL 3	3.62	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	8	80768445	125768445	Rat
8694446	Bw170	Body weight QTL 170	12.07	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	8	80768445	125768445	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	70041301	121080908	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	68690349	119799881	Rat
10450865	Bw175	Body weight QTL 175	4.1		total fat pad mass (VT:0015008)	adipose tissue molecular composition measurement (CMO:0000484)	8	84192326	129192326	Rat
724539	Cm19	Cardiac mass QTL 19	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	8	103375781	129871912	Rat
738011	Anxrr9	Anxiety related response QTL 9	6.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	8	102413464	132782436	Rat
71120	Niddm21	Non-insulin dependent diabetes mellitus QTL 21	3.73		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	8	66992095	111992095	Rat
8693654	Alc32	Alcohol consumption QTL 32	2	0.755	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	8	97492344	116428905	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	55428333	127966348	Rat
634332	Pia18	Pristane induced arthritis QTL 18	4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	84192326	132782436	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	39106363	114525825	Rat
2300181	Bmd55	Bone mineral density QTL 55	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	85348065	130348065	Rat
1300171	Bp184	Blood pressure QTL 184	3.66		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	8	79394435	132782436	Rat
2313400	Anxrr25	Anxiety related response QTL 25			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	8	98145073	122898010	Rat
8694200	Abfw4	Abdominal fat weight QTL 4	9.07	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	8	80768445	125768445	Rat
8694392	Bw161	Body weight QTL 161	8.06	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	8	80768445	125768445	Rat
61437	Cia6	Collagen induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	91340911	131690273	Rat

Markers in Region

Sox14

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	100,423,367 - 100,423,467 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	108,109,251 - 108,109,350	NCBI	Rnor6.0
Rnor_5.0	8	107,533,021 - 107,533,120	UniSTS	Rnor5.0
RGSC_v3.4	8	104,738,332 - 104,738,431	UniSTS	RGSC3.4
Celera	8	99,824,282 - 99,824,381	UniSTS
Cytogenetic Map	8	q31	UniSTS

Sox14

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	100,422,453 - 100,422,832 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	108,108,337 - 108,108,715	NCBI	Rnor6.0
Rnor_5.0	8	107,532,107 - 107,532,485	UniSTS	Rnor5.0
RGSC_v3.4	8	104,737,418 - 104,737,796	UniSTS	RGSC3.4
Celera	8	99,823,368 - 99,823,746	UniSTS
Cytogenetic Map	8	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
1	5	4	87	8	6	1	2	1	2	15	8	84	1	38	5	4	4

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106850	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EU853677	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000034277 ⟹ ENSRNOP00000063999

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	109,301,290 - 109,303,226 (-)	Ensembl
mRatBN7.2 Ensembl	8	100,421,982 - 100,423,918 (-)	Ensembl
Rnor_6.0 Ensembl	8	108,107,865 - 108,109,801 (-)	Ensembl

RefSeq Acc Id:

NM_001106850 ⟹ NP_001100320

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	109,301,290 - 109,303,226 (-)	NCBI
mRatBN7.2	8	100,421,982 - 100,423,918 (-)	NCBI
Dahl_SR_JrHsd	8	110,212,617 - 110,214,553 (-)	NCBI
Lyon_Normotensive	8	112,317,394 - 112,319,330 (-)	NCBI
Lyon_Hypertensive	8	110,806,674 - 110,808,610 (-)	NCBI
F344_StmMcwi	8	102,216,004 - 102,217,941 (-)	NCBI
Rnor_6.0	8	108,107,865 - 108,109,801 (-)	NCBI
Rnor_5.0	8	107,531,635 - 107,533,571 (-)	NCBI
RGSC_v3.4	8	104,736,946 - 104,738,882 (-)	RGD
Celera	8	99,822,896 - 99,824,832 (-)	RGD

Sequence:

show sequence

GAGAAGGCGAAGGTGAAGAGGGAGCGAAGGAGGAGCCTCCTGCCCTCGCCAGAAAATTACCTAG
CCACTTAATCCCAAGACTCTGGTACTTGGGCCCCAATCTCTGGTGCCCACAGACTCCAGGCCGA
GAGTCCTCTCCTCCCCGCTGCCCTTCCTACTCTTCGGCCCCCTGGGGGCTGCCTGGGGGCTGGG
ACTGGCATGATCAGTTGAAAACTTTGCAGGGTCAGCTCTTCTCTCTGATTTTTCCTCTGCGGCT
CCGAGACGAGGGGACTTCAGAGTCCCGGGCTCAGGACGGACAGAAAGACAGACGGCCAACCGCG
CCCAGGCACGCCCGCAGAGCCCCTGCATTCCCCGCCCCCGCCCGCCTCGCCGGGACCATGTCCA
AACCTTCAGACCACATCAAGAGGCCCATGAATGCCTTCATGGTATGGTCCCGGGGCCAGCGGCG
CAAGATGGCCCAGGAAAATCCCAAGATGCACAACTCGGAGATCAGCAAACGCCTAGGCGCCGAA
TGGAAGCTCCTGTCCGAGGCAGAGAAGCGGCCTTACATCGACGAAGCCAAAAGGCTGCGCGCCC
AGCACATGAAGGAGCACCCCGACTACAAGTACCGGCCTCGGCGCAAGCCGAAGAACCTGCTCAA
GAAAGACAGGTATGTCTTCCCCCTGCCCTACCTGGGCGACACGGACCCGCTCAAGGCGGCCGGC
CTGCCCGTGGGGGCTTCCGACGGCCTCCTGAGCGCGCCCGAGAAAGCCCGGGCCTTCTTGCCGC
CGGCCTCGGCGCCTTACTCCCTGCTGGACCCTGCGCAATTTAGTTCCAGTGCCATCCAGAAGAT
GGGTGAAGTGCCCCACACGTTGGCCACCAGCGCGCTGCCCTACGCGTCCACCCTGGGCTATCAG
AACGGCGCCTTCGGCAGTCTCAGCTGCCCCAGCCAGCATACGCACACGCACCCGTCCCCCACCA
ACCCGGGCTACGTGGTGCCCTGTAACTGTACCGCCTGGTCTGCCTCCACCCTGCAGCCCCCTGT
CGCCTACATCCTCTTCCCAGGCATGACCAAGACTGGCATAGACCCTTATTCGTCAGCCCACGCT
ACGGCCATGTAACCCCCAGCTTGGCCGGGACCTGAAGGGTGGTGTGGAAGCAGAGATCTGATTC
CTTTCCTTTGCACCTAGTCTGGCCCACAGATGCCTCTGGGTCAGGCCTACTGCTGCCCCCTGCC
CACCCCAGACTCTGCCTCTCTCTTCCAGGGGAAAAGGGAGGGGCCGCCATCCTGGACCCAAGGC
ACAGACTCGTGCTGGAAATTTCCAAACGTTTAGAAAGCTACACATGTTCCCCTCTCCCGACTCT
CCCAAAGCAAACCTCCGACTGTACCCCCTTTGGACAAAAAAAAAAGTAGGCAATTTGCTTTATT
TACGTCCCCCTCACTGTCCGCGGATAGGCTTTGGACTCGGAACTCCCAGATCCTGGTATTATAT
CTAGAACATGCGTATATATATTTTTCCTTTCCCACTGAAGAAAAGAGCTGAGTCTTGCTGCTGT
GCCATCAGACCCAGCTAGGCACCATTTGCTCTTCCCGTGTGGGGGTGAGAGGCTTAAAAGTTTA
AAACTTCAGGAAGGGAAACCTTTCTGTTTCAAACCATACTGTGGTCGTGTTTGCTTCGATAAAG
AGAAAAAAAAAAAAAGGAACCATGTGGCTTTTCACTTTGTGTACCGCAGTACTCCTAGACACCT
AAGTTTACTTTTAGACAGAATGTCAGGTAATGAAATCAGGAAGTAGAAAGTGGACAAAAACCTT
AAAATAATAATAAAAAAAAACATCCTACATGGTCATAAATGTTTTGACAATGTCTTGGAAATGT
ACCTAGAAGGATTTTTTTTTCTCATTCCTCTGTTCATTTTGTTGAACAAAGACGTTTTAAATAA
AGACAATCTGTCACTGC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001100320	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	ACJ31787	(Get FASTA)	NCBI Sequence Viewer
	EDL77429	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000063999
	ENSRNOP00000063999.1

RefSeq Acc Id:

NP_001100320 ⟸ NM_001106850

- UniProtKB:

B7SZV3 (UniProtKB/TrEMBL), M0R3S7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSKPSDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRL
RAQHMKEHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDPLKAAGLPVGASDGLLSAPEKARAF
LPPASAPYSLLDPAQFSSSAIQKMGEVPHTLATSALPYASTLGYQNGAFGSLSCPSQHTHTHPS
PTNPGYVVPCNCTAWSASTLQPPVAYILFPGMTKTGIDPYSSAHATAM

hide sequence

Ensembl Acc Id:

ENSRNOP00000063999 ⟸ ENSRNOT00000034277

Protein Domains

HMG box

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B7SZV3-F1-model_v2	AlphaFold	B7SZV3	1-240	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309654	AgrOrtholog
BioCyc Gene	G2FUF-29383	BioCyc
Ensembl Genes	ENSRNOG00000022084	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000034277	ENTREZGENE
	ENSRNOT00000034277.7	UniProtKB/TrEMBL
Gene3D-CATH	1.10.30.10	UniProtKB/TrEMBL
InterPro	HMG_box_dom_sf	UniProtKB/TrEMBL
	HMG_superfamily	UniProtKB/TrEMBL
	SOX_fam	UniProtKB/TrEMBL
	SRY-related_HMG-box_TFs	UniProtKB/TrEMBL
KEGG Report	rno:300954	UniProtKB/TrEMBL
NCBI Gene	300954	ENTREZGENE
PANTHER	PTHR10270:SF107	UniProtKB/TrEMBL
	SOX TRANSCRIPTION FACTOR	UniProtKB/TrEMBL
Pfam	HMG_box	UniProtKB/TrEMBL
	SOXp	UniProtKB/TrEMBL
PhenoGen	Sox14	PhenoGen
PROSITE	HMG_BOX_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000022084	RatGTEx
SMART	HMG	UniProtKB/TrEMBL
Superfamily-SCOP	HMG-box	UniProtKB/TrEMBL
UniProt	B7SZV3	ENTREZGENE, UniProtKB/TrEMBL
	M0R3S7	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-08-05	Sox14	SRY-box transcription factor 14	Sox14	SRY box 14	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-11-12	Sox14	SRY box 14	Sox14	SRY (sex determining region Y)-box 14	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-18	Sox14	SRY (sex determining region Y)-box 14	Sox14	SRY-box containing gene 14	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Sox14	SRY-box containing gene 14	Sox14_predicted	SRY-box containing gene 14 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Sox14_predicted	SRY-box containing gene 14 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar