Advanced Search (OLGA)

Gene: Klk13 (kallikrein related-peptidase 13) Rattus norvegicus

Analyze

Symbol:

Klk13

Name:

kallikrein related-peptidase 13

RGD ID:

1309337

Description:

Predicted to enable serine-type endopeptidase activity. Predicted to be involved in protein maturation. Predicted to act upstream of or within protein processing. Predicted to be located in cytoplasm. Predicted to be active in extracellular space and secretory granule. Orthologous to human KLK13 (kallikrein related peptidase 13); INTERACTS WITH 6-propyl-2-thiouracil; bisphenol A; cadmium dichloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

kallikrein 13; kallikrein l; kallikrein-13; Klnl; LOC292848

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	KLK13 (kallikrein related peptidase 13)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Klk13 (kallikrein related-peptidase 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	KLK13 (kallikrein related peptidase 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	KLK13 (kallikrein related peptidase 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	KLK13 (kallikrein related peptidase 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	KLK13 (kallikrein related peptidase 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Klk13 (kallikrein related peptidase 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Klk13 (kallikrein related peptidase 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	DYNLL2 (dynein light chain LC8-type 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	KLK13 (kallikrein related peptidase 13)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Klk13 (kallikrein related-peptidase 13)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG17239	Alliance	DIOPT (OMA\|OrthoFinder\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG32376	Alliance	DIOPT (InParanoid\|OMA\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG8299	Alliance	DIOPT (Hieranoid\|OMA\|OrthoFinder)
Drosophila melanogaster (fruit fly):	CG32374	Alliance	DIOPT (InParanoid\|OMA\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	LOC100485347	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	LOC100487533	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	103,301,935 - 103,314,313 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	103,301,935 - 103,313,554 (+)	Ensembl				GRCr8
mRatBN7.2	1	94,165,381 - 94,177,002 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	94,165,381 - 94,177,002 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	99,550,796 - 99,562,415 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	108,023,461 - 108,035,080 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	101,313,261 - 101,324,869 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	99,648,658 - 99,661,025 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	99,648,658 - 99,660,277 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	100,717,394 - 100,729,013 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	94,133,589 - 94,145,208 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	88,434,066 - 88,445,708 (+)	NCBI		Celera
RGSC_v3.1	1	94,211,699 - 94,223,319 (+)	NCBI
Cytogenetic Map	1	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

ovarian carcinoma (ISO)

prostate cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-hydroxypropanoic acid (ISO)

3-Hydroxybenzo[a]pyrene (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

Benzo[k]fluoranthene (ISO)

bisphenol A (EXP)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

calcitriol (ISO)

carbon nanotube (ISO)

copper atom (EXP)

copper(0) (EXP)

DDT (EXP)

formaldehyde (ISO)

lead(0) (ISO)

N-methyl-4-phenylpyridinium (EXP)

nickel atom (ISO)

ozone (ISO)

rac-lactic acid (ISO)

testosterone undecanoate (ISO)

titanium dioxide (EXP)

trichloroethene (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

protein maturation (IBA)

protein processing (ISO)

proteolysis (IEA)

Cellular Component

cytoplasm (IEA,ISO)

extracellular space (IBA,IEA,ISO)

secretory granule (IBA,IEA,ISO)

Molecular Function

endopeptidase activity (IEA,ISO)

hydrolase activity (IEA,ISO)

peptidase activity (IEA)

protein binding (ISO)

serine-type endopeptidase activity (IBA,IEA)

serine-type peptidase activity (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Klk1 as one of the genes contributing to hypertension in Dahl salt-sensitive rat.	Iwai N, etal., Hypertension 2005 May;45(5):947-53. Epub 2005 Apr 4.
4.	Immunohistochemical localization of human kallikreins 6, 10 and 13 in benign and malignant prostatic tissues.	Petraki CD, etal., Prostate Cancer Prostatic Dis. 2003;6(3):223-7.
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	KLK6 and KLK13 predict tumor recurrence in epithelial ovarian carcinoma.	White NM, etal., Br J Cancer. 2009 Oct 6;101(7):1107-13.

Additional References at PubMed

PMID:12642628	PMID:14687906	PMID:16423834	PMID:18344018	PMID:23376485

Genomics

Comparative Map Data

Klk13
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	103,301,935 - 103,314,313 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	103,301,935 - 103,313,554 (+)	Ensembl				GRCr8
mRatBN7.2	1	94,165,381 - 94,177,002 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	94,165,381 - 94,177,002 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	99,550,796 - 99,562,415 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	108,023,461 - 108,035,080 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	101,313,261 - 101,324,869 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	99,648,658 - 99,661,025 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	99,648,658 - 99,660,277 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	100,717,394 - 100,729,013 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	94,133,589 - 94,145,208 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	88,434,066 - 88,445,708 (+)	NCBI		Celera
RGSC_v3.1	1	94,211,699 - 94,223,319 (+)	NCBI
Cytogenetic Map	1	q22	NCBI

KLK13
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	51,055,626 - 51,065,679 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	51,055,626 - 51,065,114 (-)	Ensembl			hg38	GRCh38
GRCh37	19	51,558,883 - 51,568,349 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	56,251,275 - 56,260,179 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	56,251,274 - 56,260,179	NCBI
Celera	19	48,611,530 - 48,620,443 (-)	NCBI		Celera
Cytogenetic Map	19	q13.41	NCBI
HuRef	19	47,892,411 - 47,901,418 (-)	NCBI		HuRef
CHM1_1	19	51,561,456 - 51,570,367 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	54,144,220 - 54,154,419 (-)	NCBI		T2T-CHM13v2.0

Klk13
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	43,361,991 - 43,377,288 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	43,361,991 - 43,376,958 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	43,712,567 - 43,727,864 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	43,712,567 - 43,727,534 (+)	Ensembl			mm10	GRCm38
MGSCv37	7	50,967,937 - 50,982,128 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	43,580,609 - 43,594,800 (+)	NCBI		MGSCv36	mm8
Celera	7	39,178,815 - 39,193,033 (+)	NCBI		Celera
Cytogenetic Map	7	B3	NCBI
cM Map	7	28.26	NCBI

KLK13
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	57,124,773 - 57,134,828 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	59,046,277 - 59,056,318 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	48,022,614 - 48,032,624 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	56,912,192 - 56,920,749 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	56,912,192 - 56,920,749 (-)	Ensembl			panPan2	panpan1.1

KLK13
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	105,825,192 - 105,835,724 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	105,826,848 - 105,834,890 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	105,399,457 - 105,409,690 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	106,336,133 - 106,346,244 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	106,336,155 - 106,343,855 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	106,007,618 - 106,017,727 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	105,648,735 - 105,659,078 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	106,444,195 - 106,454,544 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

KLK13
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	55,703,392 - 55,713,532 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	55,703,414 - 55,712,976 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

KLK13
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	44,069,309 - 44,085,681 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	44,069,324 - 44,083,884 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666073	24,120,633 - 24,130,743 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Klk13
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624832	3,712,317 - 3,720,830 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624832	3,695,558 - 3,720,962 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Klk13
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	155,670,123 - 155,681,697 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Klk13
145 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	39
Count of miRNA genes:	38
Interacting mature miRNAs:	38
Transcripts:	ENSRNOT00000039531
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	87889942	132889942	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	39728272	132889942	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	102780511	182384005	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
2300324	Fetw1	Fetal weight QTL 1	12.1	0.005	fetal growth trait (VT:0004201)	fetal body weight (CMO:0002080)	1	92963855	109494029	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	101228864	146228864	Rat
1331800	Scl25	Serum cholesterol level QTL 25	3.013		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	87785026	142582336	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	83019780	128019780	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	66404680	111404680	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	93903998	191260518	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	66400974	132889942	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	84107164	115183752	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	91302413	136302413	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
724567	Tcas6	Tongue tumor susceptibility QTL 6	6.85		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	1	102359314	153680016	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	99645382	182701046	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	99645382	221502378	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	86622262	131622262	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	58769992	103769992	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	66077886	111077886	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	98879955	208479939	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of, or within a discrete space in an open field apparatus (CMO:0001514)	1	92683681	137683681	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	52891222	109116986	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	86993904	131993904	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	87558587	132558587	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	92683681	137683681	Rat
737977	Bp160	Blood pressure QTL 160		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	97582336	142582336	Rat
2293142	Bp314	Blood pressure QTL 314			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	101594089	146594089	Rat
61433	Cia2	Collagen induced arthritis QTL 2	5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	100345976	145345976	Rat
724529	Cm16	Cardiac mass QTL 16	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	1	96717367	160111531	Rat

Markers in Region

D1Got85

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	94,172,555 - 94,172,739 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	99,655,833 - 99,656,014	NCBI	Rnor6.0
Rnor_5.0	1	100,724,569 - 100,724,750	UniSTS	Rnor5.0
RGSC_v3.4	1	94,140,763 - 94,140,945	RGD	RGSC3.4
RGSC_v3.4	1	94,140,764 - 94,140,945	UniSTS	RGSC3.4
Celera	1	88,441,234 - 88,441,415	UniSTS
RGSC_v3.1	1	94,218,875 - 94,219,056	RGD
RH 3.4 Map	1	884.49	UniSTS
RH 3.4 Map	1	884.49	RGD
RH 2.0 Map	1	564.4	RGD
Cytogenetic Map	1	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
5	16	44	29	33	11	3	11	6	66	28	29	22	57	22

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001170405	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008759331	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063283826	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063283832	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LT631621	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000039531 ⟹ ENSRNOP00000032820

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	103,301,935 - 103,313,554 (+)	Ensembl
mRatBN7.2 Ensembl	1	94,165,381 - 94,177,002 (+)	Ensembl
Rnor_6.0 Ensembl	1	99,648,658 - 99,660,277 (+)	Ensembl

RefSeq Acc Id:

NM_001170405 ⟹ NP_001163876

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	103,301,935 - 103,313,554 (+)	NCBI
mRatBN7.2	1	94,165,381 - 94,177,002 (+)	NCBI
Rnor_6.0	1	99,648,658 - 99,660,277 (+)	NCBI
Rnor_5.0	1	100,717,394 - 100,729,013 (+)	NCBI
RGSC_v3.4	1	94,133,589 - 94,145,208 (+)	RGD
Celera	1	88,434,066 - 88,445,708 (+)	RGD

Sequence:

show sequence

CTCGGGCTCCTCCTGACAGGAGCCCAGGGGCACTTGATAGATACCCTCTTAGGCCTGGCACCTA
TGGTGGCTTATGTCTTGGGAAAGAGGTGATGAACAAATGTGGTCATATCCTTAAATTTCAGAAG
AAAAAAAGGTTGGAGGCCCCGCCCACCCTGCCCACCCCCCATCCCGGAGCTATCATGTGGCCCC
TAGTGGCTACCATCGCTTGCCTGACCTTGGCCTTGTCCGGAGGAATCTCCCGGGACTACCCCAA
GATTCTCAATGGGACCAATGGGACCAGTGGTTTTCTCCCAGGTGGCTACACCTGCCTTCCCCAT
TCTCAGCCTTGGCAGGCAGCTCTACTGGTCCGTGGACGACTTCTCTGTGGAGGGGTTCTGGTTC
ACCCCAAATGGGTACTCACAGCAGCTCACTGCAGGAAAGATGGGTACACAGTTCATCTGGGCAA
GCATGCCCTGGGGCGTGTGGAGAATGGCGAGCAGGCAATGGAGGTGGTCCGCTCTATCCCCCAT
CCTGAATACCAGGTCAGCCCCACCCACCTGAACCATGACCATGACATCATGCTTCTGGAGTTGA
AGTCTCCTGTCCAGCTCAGCAACCACGTCCGTACTCTGCAGCTCTCGGCAGACGACTGCCTGCC
CACTGGCACCTGCTGTCGTGTTTCTGGCTGGGGCACCACCACCAGCCCCCAGGTGAATTACCCC
AAAACTCTGCAGTGCGCCAACATTGAACTGCGCTCAGATGAGGAGTGCCGGCAGGTGTATCCCG
GGAAGATCACTGCCAACATGCTCTGTGCTGGTACCAAAGAAGGGGGAAAGGACTCCTGTGAGGG
TGATTCCGGGGGTCCACTGATTTGCAATGGCAAACTCTACGGCATCATCTCATGGGGGGATTTT
CCATGTGGACAGCCCAACCGACCTGGCGTTTACACACGAGTCTCAAAATACCTGCGTTGGATCC
AGGGGACCATCAGAAACACTCCGGAGCAGGGATGGACAAAGGGCACACAATAAAACTGTGTTCG
TTTGCCTGCCTCCC

hide sequence

RefSeq Acc Id:

XM_063283826 ⟹ XP_063139896

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	103,302,445 - 103,314,313 (+)	NCBI

RefSeq Acc Id:

XM_063283832 ⟹ XP_063139902

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	103,302,493 - 103,314,313 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001163876	(Get FASTA)	NCBI Sequence Viewer
	XP_063139896	(Get FASTA)	NCBI Sequence Viewer
	XP_063139902	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000032820
	ENSRNOP00000032820.3
GenBank Protein	SFW93268	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001163876 ⟸ NM_001170405
- Peptide Label:	precursor
- UniProtKB:	D3ZJ70 (UniProtKB/TrEMBL)
- Sequence:	show sequence MWPLVATIACLTLALSGGISRDYPKILNGTNGTSGFLPGGYTCLPHSQPWQAALLVRGRLLCGG VLVHPKWVLTAAHCRKDGYTVHLGKHALGRVENGEQAMEVVRSIPHPEYQVSPTHLNHDHDIML LELKSPVQLSNHVRTLQLSADDCLPTGTCCRVSGWGTTTSPQVNYPKTLQCANIELRSDEECRQ VYPGKITANMLCAGTKEGGKDSCEGDSGGPLICNGKLYGIISWGDFPCGQPNRPGVYTRVSKYL RWIQGTIRNTPEQGWTKGTQ hide sequence

Ensembl Acc Id:

ENSRNOP00000032820 ⟸ ENSRNOT00000039531

RefSeq Acc Id:	XP_063139896 ⟸ XM_063283826
- Peptide Label:	isoform X1
- UniProtKB:	D3ZJ70 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063139902 ⟸ XM_063283832
- Peptide Label:	isoform X1
- UniProtKB:	D3ZJ70 (UniProtKB/TrEMBL)

Protein Domains

Peptidase S1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZJ70-F1-model_v2	AlphaFold	D3ZJ70	1-276	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309337	AgrOrtholog
BioCyc Gene	G2FUF-59825	BioCyc
Ensembl Genes	ENSRNOG00000022353	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000039531	ENTREZGENE
	ENSRNOT00000039531.6	UniProtKB/TrEMBL
Gene3D-CATH	2.40.10.10	UniProtKB/TrEMBL
InterPro	Peptidase_S1/S6_AS	UniProtKB/TrEMBL
	Peptidase_S1_PA_chymotrypsin	UniProtKB/TrEMBL
	Peptidase_S1_S6	UniProtKB/TrEMBL
	Peptidase_S1A	UniProtKB/TrEMBL
	Ser/Cys_Pept_Trypsin-like	UniProtKB/TrEMBL
	TRYPSIN_SER	UniProtKB/TrEMBL
KEGG Report	rno:292848	UniProtKB/TrEMBL
NCBI Gene	292848	ENTREZGENE
PANTHER	KALLIKREIN-13	UniProtKB/TrEMBL
	KALLIKREIN-RELATED	UniProtKB/TrEMBL
Pfam	Trypsin	UniProtKB/TrEMBL
PhenoGen	Klk13	PhenoGen
PRINTS	CHYMOTRYPSIN	UniProtKB/TrEMBL
PROSITE	TRYPSIN_DOM	UniProtKB/TrEMBL
	TRYPSIN_HIS	UniProtKB/TrEMBL
	TRYPSIN_SER	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000022353	RatGTEx
SMART	Tryp_SPc	UniProtKB/TrEMBL
Superfamily-SCOP	Pept_Ser_Cys	UniProtKB/TrEMBL
UniProt	D3ZJ70	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-04	Klk13	kallikrein related-peptidase 13	Klk13_predicted	kallikrein 13 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-12	Klk13_predicted	kallikrein 13 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message