Advanced Search (OLGA)

Gene: Guca1a (guanylate cyclase activator 1A) Rattus norvegicus

Analyze

Symbol:

Guca1a

Name:

guanylate cyclase activator 1A

RGD ID:

1308712

Description:

Predicted to enable calcium ion binding activity and calcium sensitive guanylate cyclase activator activity. Involved in positive regulation of cGMP-mediated signaling. Located in photoreceptor inner segment and photoreceptor outer segment. Human ortholog(s) of this gene implicated in cone-rod dystrophy 14. Orthologous to several human genes including GUCA1ANB-GUCA1A (GUCA1ANB-GUCA1A readthrough); PARTICIPATES IN calcium/calcium-mediated signaling pathway; visual phototransduction pathway; INTERACTS WITH amitrole; bisphenol A; cadmium atom.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

GCAP1; guanylate cyclase activator 1a (retina); guanylate cyclase-activating protein, photoreceptor 1; guanylyl cyclase-activating protein 1; LOC301233; p19

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	21,080,782 - 21,096,221 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	9	21,086,642 - 21,096,221 (+)	Ensembl				GRCr8
mRatBN7.2	9	13,588,988 - 13,598,566 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	13,588,525 - 13,598,565 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	9	22,168,815 - 22,178,406 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	27,232,681 - 27,242,268 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	25,532,230 - 25,541,815 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	15,609,804 - 15,620,030 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	15,609,804 - 15,620,029 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	9	14,530,794 - 14,541,020 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	9	9,046,617 - 9,056,984 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	9	11,338,757 - 11,349,075 (+)	NCBI		Celera
RGSC_v3.1	9	9,044,401 - 9,054,301 (+)	NCBI
Cytogenetic Map	9	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

cone-rod dystrophy 14 (ISO)

Hereditary Eye Diseases (ISO)

retinitis pigmentosa (ISO)

retinitis pigmentosa 1 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (ISO)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,4,4'-trichlorobiphenyl (ISO)

4,4'-sulfonyldiphenol (ISO)

acrylamide (ISO)

amitrole (EXP)

aristolochic acid A (ISO)

Azoxymethane (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (EXP)

cadmium dichloride (EXP)

carbamazepine (ISO)

chlordecone (ISO)

chlorpyrifos (ISO)

clofibrate (ISO)

clotrimazole (EXP)

deoxycholic acid (ISO)

dexamethasone (EXP)

dextran sulfate (ISO)

dorsomorphin (ISO)

entinostat (ISO)

ethylparaben (ISO)

glyphosate (EXP)

lead diacetate (EXP)

mercury dibromide (ISO)

methimazole (EXP)

methylmercury chloride (ISO)

monosodium L-glutamate (ISO)

nicotine (ISO)

paracetamol (ISO)

PCB138 (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

SB 431542 (ISO)

sulfadimethoxine (EXP)

testosterone (EXP)

thimerosal (ISO)

titanium dioxide (ISO)

triadimefon (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triptonide (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

phototransduction (IEA,ISO)

positive regulation of guanylate cyclase activity (IDA)

regulation of signal transduction (IBA)

visual perception (IBA,IEA,ISO)

Cellular Component

cone photoreceptor outer segment (IBA,IEA,ISO)

photoreceptor inner segment (IBA,IDA,IEA,ISO)

photoreceptor outer segment (IDA,IEA,ISO)

Molecular Function

calcium ion binding (IBA,IEA)

calcium sensitive guanylate cyclase activator activity (IBA,IEA,ISO)

guanylate cyclase regulator activity (IEA,ISO)

metal ion binding (IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

calcium/calcium-mediated signaling pathway (ISO)

visual phototransduction pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Photoreceptor signaling: supporting vision across a wide range of light intensities.	Arshavsky VY and Burns ME, J Biol Chem. 2012 Jan 13;287(3):1620-6. Epub 2011 Nov 10.
2.	The localization of guanylyl cyclase-activating proteins in the mammalian retina.	Cuenca N, etal., Invest Ophthalmol Vis Sci. 1998 Jun;39(7):1243-50.
3.	p19 detected in the rat retina and pineal gland is a guanylyl cyclase-activating protein (GCAP).	Dejda A, etal., Acta Biochim Pol. 2002;49(4):899-905.
4.	Negatively calcium-modulated membrane guanylate cyclase signaling system in the rat olfactory bulb.	Duda T, etal., Biochemistry. 2001 Apr 17;40(15):4654-62.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	The diversity of calcium sensor proteins in the regulation of neuronal function.	McCue HV, etal., Cold Spring Harb Perspect Biol. 2010 Aug;2(8):a004085. doi: 10.1101/cshperspect.a004085. Epub 2010 Jul 28.
8.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
9.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
10.	A mutation in guanylate cyclase activator 1A (GUCA1A) in an autosomal dominant cone dystrophy pedigree mapping to a new locus on chromosome 6p21.1.	Payne AM, etal., Hum Mol Genet. 1998 Feb;7(2):273-7.
11.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
12.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:11493703	PMID:15173221	PMID:15336959	PMID:19332500	PMID:22183407

Genomics

Comparative Map Data

Guca1a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	21,080,782 - 21,096,221 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	9	21,086,642 - 21,096,221 (+)	Ensembl				GRCr8
mRatBN7.2	9	13,588,988 - 13,598,566 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	13,588,525 - 13,598,565 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	9	22,168,815 - 22,178,406 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	27,232,681 - 27,242,268 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	25,532,230 - 25,541,815 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	15,609,804 - 15,620,030 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	15,609,804 - 15,620,029 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	9	14,530,794 - 14,541,020 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	9	9,046,617 - 9,056,984 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	9	11,338,757 - 11,349,075 (+)	NCBI		Celera
RGSC_v3.1	9	9,044,401 - 9,054,301 (+)	NCBI
Cytogenetic Map	9	q12	NCBI

GUCA1A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	42,173,364 - 42,180,056 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	42,173,364 - 42,181,338 (+)	Ensembl			hg38	GRCh38
GRCh37	6	42,141,102 - 42,147,794 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Cytogenetic Map	6	p21.1	NCBI
HuRef	6	41,841,195 - 41,865,841 (+)	NCBI		HuRef
CHM1_1	6	42,125,607 - 42,150,271 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	42,001,569 - 42,008,260 (+)	NCBI		T2T-CHM13v2.0

Guca1a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	47,705,482 - 47,724,439 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	47,705,483 - 47,711,509 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	17	47,394,557 - 47,413,514 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	47,394,558 - 47,400,584 (-)	Ensembl			mm10	GRCm38
MGSCv37	17	47,531,507 - 47,537,533 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	17	46,857,749 - 46,863,775 (-)	NCBI		MGSCv36	mm8
Celera	17	50,829,365 - 50,835,380 (-)	NCBI		Celera
Cytogenetic Map	17	C	NCBI
cM Map	17	23.07	NCBI

Guca1a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955437	8,376,091 - 8,382,640 (+)	Ensembl
ChiLan1.0	NW_004955437	8,370,553 - 8,382,640 (+)	NCBI	ChiLan1.0	ChiLan1.0

GUCA1A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	56,669,264 - 56,676,039 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	52,539,219 - 52,545,995 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	41,693,593 - 41,774,591 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	43,045,278 - 43,069,312 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	43,045,307 - 43,070,520 (+)	Ensembl			panPan2	panpan1.1

Guca1a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	46,258,921 - 46,269,718 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936476	17,691,045 - 17,701,859 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936476	17,690,484 - 17,701,288 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GUCA1A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	37,282,700 - 37,296,717 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	37,282,630 - 37,296,713 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	42,752,943 - 42,760,474 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GUCA1A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	29,972,216 - 29,984,653 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	29,972,862 - 29,977,487 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666044	42,195,158 - 42,201,833 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Guca1a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624754	17,089,026 - 17,094,231 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624754	17,089,061 - 17,105,538 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Guca1a
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	4	82,476,542 - 82,486,204 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Guca1a
137 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	292
Count of miRNA genes:	128
Interacting mature miRNAs:	133
Transcripts:	ENSRNOT00000020902, ENSRNOT00000065904
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303170	Bp332	Blood pressure QTL 332	3.73	0.027	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	6714888	84474983	Rat
631211	Bw4	Body weight QTL4	5.31		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	9	5346479	50346479	Rat
10054141	Gmadr4	Adrenal mass QTL 4	2.45	0.0074	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	9	1	21707400	Rat
2303559	Gluco54	Glucose level QTL 54	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	9	8750492	53750492	Rat
7207814	Bmd91	Bone mineral density QTL 91	3.5		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	9	1	31250552	Rat
9589055	Scfw5	Subcutaneous fat weight QTL 5	5.55	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	9	496645	45496645	Rat
1641911	Alcrsp13	Alcohol response QTL 13			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	9	6214995	51214995	Rat
1354650	Despr5	Despair related QTL 5	4.01	0.0017	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	9	8750492	53750492	Rat
1300124	Cm4	Cardiac mass QTL 4	3.55		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	9	1	41763315	Rat
61425	Cia15	Collagen induced arthritis QTL 15	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	9	5346479	50416711	Rat
631643	Bp120	Blood pressure QTL 120	3	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	6714888	29567695	Rat
9589158	Gluco65	Glucose level QTL 65	6.82	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	9	496645	45496645	Rat
1600365	Mcs20	Mammary carcinoma susceptibility QTL 20	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	9	21031430	49025574	Rat
7411592	Foco8	Food consumption QTL 8	7.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	496645	45496645	Rat
1298088	Edpm11	Estrogen-dependent pituitary mass QTL 11	2.5		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	6214995	51214995	Rat

Markers in Region

RH135391

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	9	21,095,965 - 21,096,182 (+)	Marker Load Pipeline
mRatBN7.2	9	13,598,310 - 13,598,527 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	15,619,775 - 15,619,991	NCBI	Rnor6.0
Rnor_5.0	9	14,540,765 - 14,540,981	UniSTS	Rnor5.0
RGSC_v3.4	9	9,056,730 - 9,056,946	UniSTS	RGSC3.4
Celera	9	11,348,821 - 11,349,037	UniSTS
RH 3.4 Map	9	60.2	UniSTS
Cytogenetic Map	9	q12	UniSTS

RH138598

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	13,594,428 - 13,594,558 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	15,615,893 - 15,616,022	NCBI	Rnor6.0
Rnor_5.0	9	14,536,883 - 14,537,012	UniSTS	Rnor5.0
RGSC_v3.4	9	9,052,848 - 9,052,977	UniSTS	RGSC3.4
Celera	9	11,344,939 - 11,345,068	UniSTS
RH 3.4 Map	9	45.4	UniSTS
Cytogenetic Map	9	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
15	1	12	111	44	40	28	11	28	6	95	35	99	16	55	12	15	15

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106887	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039083176	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010054578	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473987	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000020902 ⟹ ENSRNOP00000020902

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	9	21,086,642 - 21,096,221 (+)	Ensembl
mRatBN7.2 Ensembl	9	13,588,525 - 13,598,565 (+)	Ensembl
Rnor_6.0 Ensembl	9	15,609,804 - 15,620,029 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000065904 ⟹ ENSRNOP00000062988

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	9	15,610,438 - 15,619,811 (+)	Ensembl

RefSeq Acc Id:

NM_001106887 ⟹ NP_001100357

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	21,086,642 - 21,096,221 (+)	NCBI
mRatBN7.2	9	13,588,988 - 13,598,566 (+)	NCBI
Rnor_6.0	9	15,609,804 - 15,620,029 (+)	NCBI
Rnor_5.0	9	14,530,794 - 14,541,020 (+)	NCBI
RGSC_v3.4	9	9,046,617 - 9,056,984 (+)	RGD
Celera	9	11,338,757 - 11,349,075 (+)	RGD

Sequence:

show sequence

GAGGGAATGCTTCCATCCGGGAGAAATGGAATATACTGTTCGGGGTTCCTTCCAGCTCCTGGGG
ACATGTCTTAGAAGTCCCTAAAGGCTGAACTTGCACAGTTCTCATGTGACTGAAGCCCTCAGTG
ACGGCCAGGGAGAGTGTACCCAGCCCTGGCCAGCTGCATACAGACGCCCAGTCAAGGGCGGCAG
CATGGCCTCAGTGTGGGAAAGGAACCAGATCTATTTAATATATTACAGCAGTTCCATGTCTTAA
GTCCGTCTCTCGTGAGCCTGGACCATGGGCAACGTCGTGGAGGGCAAGTCGGTGGAGGAGCTGA
GTAGCACCGAATGCCATCAGTGGTACAAGAAATTCATGACGGAGTGCCCCTCTGGCCAGCTCAC
CCTCTACGAATTCCGCCAATTCTTTGGCCTCAAGAACCTGAGCCCCTCAGCCAGCCAGTATGTG
GAACAGATGTTCGAGACCTTTGACTTCAACAAGGATGGCTATATTGACTTCATGGAGTACGTGG
CCGCCCTCAGCCTGGTTCTCAAGGGCAAGGTGGAACAGAAGTTGCGTTGGTATTTCAAGCTCTA
CGACGTGGACGGCAACGGGTGCATAGACCGGGACGAGCTGCTCACCATCATCCGGGCCATCCGA
ACCATTAATCCCTGGAGCGACTCATCCATGAGCGCTGAAGAATTCACAGATACCGTGTTTGCCA
AGATCGACATCAACGGGGATGGGGAACTGTCTCTGGAGGAGTTCATGGAAGGTGTCCAGAAGGA
CCAGATGCTCCTGGACACGCTGACCCGAAGCCTGGACTTGACCCGCATTGTGCGCAGACTTCAG
AACGGCGAGCAGGAGGAGGCAGGCGCTGGCGACCTGGCAGCGGAGGCTGCCGGTTGAGCCTCAC
CCTGTGGTCTGGGTGCTGAGGGCTGGCCCCCTGCGGTGCCTGGTGTAGTTGTTCTGTTCTTGTC
TTAACATTACATAGAACCTCCCGAACACAG

hide sequence

RefSeq Acc Id:

XM_039083176 ⟹ XP_038939104

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	21,093,479 - 21,096,215 (+)	NCBI
mRatBN7.2	9	13,595,800 - 13,598,566 (+)	NCBI

RefSeq Acc Id:

XR_010054578

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	21,080,782 - 21,096,095 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001100357	(Get FASTA)	NCBI Sequence Viewer
	XP_038939104	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM18878	(Get FASTA)	NCBI Sequence Viewer
	EDM18879	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000020902
	ENSRNOP00000020902.4

RefSeq Acc Id:

NP_001100357 ⟸ NM_001106887

- UniProtKB:

D3ZII9 (UniProtKB/TrEMBL), A6JIK4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGNVVEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFD
FNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIRAIRTINPWSDS
SMSAEEFTDTVFAKIDINGDGELSLEEFMEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQEEAG
AGDLAAEAAG

hide sequence

Ensembl Acc Id:

ENSRNOP00000062988 ⟸ ENSRNOT00000065904

Ensembl Acc Id:

ENSRNOP00000020902 ⟸ ENSRNOT00000020902

RefSeq Acc Id:	XP_038939104 ⟸ XM_039083176
- Peptide Label:	isoform X1

Protein Domains

EF-hand

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZII9-F1-model_v2	AlphaFold	D3ZII9	1-202	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308712	AgrOrtholog
BioCyc Gene	G2FUF-28261	BioCyc
Ensembl Genes	ENSRNOG00000015402	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000020902	ENTREZGENE
	ENSRNOT00000020902.8	UniProtKB/TrEMBL
Gene3D-CATH	EF-hand	UniProtKB/TrEMBL
InterPro	EF-hand-like_dom	UniProtKB/TrEMBL
	EF_Hand_1_Ca_BS	UniProtKB/TrEMBL
	EF_hand_Ca-bd	UniProtKB/TrEMBL
	Recoverin	UniProtKB/TrEMBL
KEGG Report	rno:301233	UniProtKB/TrEMBL
NCBI Gene	301233	ENTREZGENE
PANTHER	PTHR23055	UniProtKB/TrEMBL
	PTHR23055:SF13	UniProtKB/TrEMBL
Pfam	EF-hand_1	UniProtKB/TrEMBL
	EF_hand_5	UniProtKB/TrEMBL
PhenoGen	Guca1a	PhenoGen
PRINTS	RECOVERIN	UniProtKB/TrEMBL
PROSITE	EF_HAND_1	UniProtKB/TrEMBL
	EF_HAND_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000015402	RatGTEx
SMART	EFh	UniProtKB/TrEMBL
Superfamily-SCOP	SSF47473	UniProtKB/TrEMBL
UniProt	A6JIK4	ENTREZGENE, UniProtKB/TrEMBL
	D3ZII9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-25	Guca1a	guanylate cyclase activator 1A	Guca1a	guanylate cyclase activator 1a (retina)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Guca1a	guanylate cyclase activator 1a (retina)	Guca1a_predicted	guanylate cyclase activator 1a (retina) (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Guca1a_predicted	guanylate cyclase activator 1a (retina) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)