Advanced Search (OLGA)

Gene: Lurap1l (leucine rich adaptor protein 1-like) Rattus norvegicus

Analyze

Symbol:

Lurap1l

Name:

leucine rich adaptor protein 1-like

RGD ID:

1308059

Description:

Predicted to be involved in regulation of signal transduction. Orthologous to human LURAP1L (leucine rich adaptor protein 1 like); INTERACTS WITH 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane; 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hypothetical protein LOC362535; LOC362535; MGC109234; RGD1308059; similar to DNA segment, Chr 4, Brigham & Womens Genetics 0951 expressed; uncharacterized protein C9orf150 homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	100,402,921 - 100,455,479 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	100,407,483 - 100,455,478 (+)	Ensembl				GRCr8
mRatBN7.2	5	95,362,005 - 95,409,439 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	95,362,005 - 95,409,438 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	97,741,551 - 97,801,762 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	99,562,563 - 99,610,036 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	99,552,400 - 99,612,615 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	98,468,039 - 98,515,126 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	98,469,047 - 98,515,125 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	102,512,705 - 102,558,784 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	99,599,574 - 99,647,041 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	93,934,901 - 93,982,041 (+)	NCBI		Celera
RGSC_v3.1	5	99,604,799 - 99,652,266 (+)	NCBI
Cytogenetic Map	5	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

esophageal atresia/tracheoesophageal fistula (ISO)

Experimental Liver Cirrhosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (EXP)

1,1-dichloroethene (ISO)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

1-nitropyrene (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3',5'-cyclic AMP (EXP)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

acetamide (EXP)

acrylamide (EXP)

aflatoxin B1 (EXP,ISO)

alpha-Zearalanol (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

azathioprine (ISO)

azoxystrobin (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

cadmium dichloride (EXP,ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

chlorpyrifos (EXP)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

DDE (ISO)

Didecyldimethylammonium (ISO)

diuron (EXP,ISO)

doxorubicin (ISO)

endosulfan (EXP)

ethanol (ISO)

fluoranthene (ISO)

folic acid (ISO)

gentamycin (EXP)

glafenine (EXP)

glyphosate (EXP)

imidacloprid (EXP)

inulin (ISO)

leflunomide (ISO)

levofloxacin (EXP)

metformin (EXP)

methylparaben (ISO)

mono(2-ethylhexyl) phthalate (EXP)

N-nitrosodimethylamine (EXP)

N-Nitrosopyrrolidine (ISO)

nickel sulfate (ISO)

paracetamol (EXP,ISO)

PCB138 (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenformin (EXP)

pregnenolone 16alpha-carbonitrile (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

sunitinib (ISO)

tetrachloromethane (EXP,ISO)

thiabendazole (EXP)

thioacetamide (EXP)

trichloroethene (ISO)

trichostatin A (ISO)

triclosan (ISO)

triphenyl phosphate (EXP)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

positive regulation of canonical NF-kappaB signal transduction (IEA)

regulation of signal transduction (IBA)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15489334

Genomics

Comparative Map Data

Lurap1l
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	100,402,921 - 100,455,479 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	100,407,483 - 100,455,478 (+)	Ensembl				GRCr8
mRatBN7.2	5	95,362,005 - 95,409,439 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	95,362,005 - 95,409,438 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	97,741,551 - 97,801,762 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	99,562,563 - 99,610,036 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	99,552,400 - 99,612,615 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	98,468,039 - 98,515,126 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	98,469,047 - 98,515,125 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	102,512,705 - 102,558,784 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	99,599,574 - 99,647,041 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	93,934,901 - 93,982,041 (+)	NCBI		Celera
RGSC_v3.1	5	99,604,799 - 99,652,266 (+)	NCBI
Cytogenetic Map	5	q31	NCBI

LURAP1L
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	12,775,020 - 12,823,060 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	12,775,020 - 12,823,060 (+)	Ensembl			hg38	GRCh38
GRCh37	9	12,775,019 - 12,823,059 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	12,765,012 - 12,813,059 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	9	12,765,011 - 12,813,058	NCBI
Celera	9	12,707,578 - 12,755,676 (+)	NCBI		Celera
Cytogenetic Map	9	p23	NCBI
HuRef	9	12,739,601 - 12,787,743 (+)	NCBI		HuRef
CHM1_1	9	12,775,334 - 12,823,392 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	12,784,296 - 12,832,387 (+)	NCBI		T2T-CHM13v2.0

Lurap1l
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	80,828,923 - 80,872,538 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	80,828,883 - 80,873,865 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	80,910,686 - 80,954,301 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	80,910,646 - 80,955,628 (+)	Ensembl			mm10	GRCm38
MGSCv37	4	80,556,590 - 80,600,205 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	80,381,917 - 80,425,532 (+)	NCBI		MGSCv36	mm8
Celera	4	79,465,779 - 79,509,552 (+)	NCBI		Celera
Cytogenetic Map	4	C3	NCBI
cM Map	4	37.91	NCBI

Lurap1l
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955434	15,995,549 - 16,035,055 (+)	Ensembl
ChiLan1.0	NW_004955434	15,995,549 - 16,035,055 (+)	NCBI	ChiLan1.0	ChiLan1.0

LURAP1L
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	111,711,836 - 111,760,337 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	111,716,849 - 111,765,826 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	12,613,596 - 12,662,950 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	13,061,445 - 13,110,852 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	13,061,445 - 13,109,923 (+)	Ensembl			panPan2	panpan1.1

LURAP1L
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	33,388,300 - 33,437,549 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	33,388,633 - 33,436,246 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	32,098,586 - 32,147,310 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	34,294,095 - 34,342,801 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	34,294,847 - 34,342,801 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	33,000,049 - 33,048,799 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	32,785,135 - 32,833,387 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	33,447,312 - 33,496,051 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Lurap1l
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	148,167,431 - 148,216,200 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936539	6,619,922 - 6,668,214 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936539	6,620,747 - 6,668,544 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LURAP1L
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	209,620,907 - 209,668,913 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	1	209,621,712 - 209,668,924 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	233,577,587 - 233,603,961 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LURAP1L
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	66,726,211 - 66,773,620 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	66,726,215 - 66,773,627 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666038	54,961,564 - 55,008,847 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Lurap1l
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624736	17,091,198 - 17,141,023 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624736	17,091,115 - 17,137,503 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Lurap1l
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	72,637,759 - 72,678,363 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Lurap1l
308 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	61
Count of miRNA genes:	43
Interacting mature miRNAs:	57
Transcripts:	ENSRNOT00000041374
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1357396	Bw44	Body weight QTL 44	4.19		body mass (VT:0001259)	body weight (CMO:0000012)	5	73779642	118779642	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	44924861	153890773	Rat
61380	Edpm5	Estrogen-dependent pituitary mass QTL 5	4.5	0.92	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	5	73779642	103472210	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	38207390	136631402	Rat
1298070	Scl18	Serum cholesterol level QTL 18	3.7		blood LDL cholesterol amount (VT:0000181)	calculated plasma low density lipoprotein cholesterol level (CMO:0001245)	5	84630798	129630798	Rat
61386	Bp49	Blood pressure QTL 49	16.6		cerebrum integrity trait (VT:0010549)	brain infarction volume (CMO:0001013)	5	65089051	103648916	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	99905133	172190305	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	48523123	134369373	Rat
2302381	Bw84	Body weight QTL 84	4.47		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	5	73779642	118779642	Rat
1357402	Bw46	Body weight QTL 46	4.47		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	5	73779642	118779642	Rat
7411582	Foco3	Food consumption QTL 3	7.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	92583776	137583776	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	65089051	166764498	Rat
1331782	Rf36	Renal function QTL 36	3.296		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	39019942	102105896	Rat
1598859	Cm66	Cardiac mass QTL 66	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	84630798	129630798	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	51657967	166600247	Rat
7411564	Bw135	Body weight QTL 135		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	92583776	137583776	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	98972960	143972960	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55124766	172190305	Rat
7411601	Foco12	Food consumption QTL 12	19.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	92583776	137583776	Rat
7394708	Emca11	Estrogen-induced mammary cancer QTL 11			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	73176602	118176602	Rat
1598846	Bp293	Blood pressure QTL 293	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	84630798	129630798	Rat
7394710	Emca12	Estrogen-induced mammary cancer QTL 12			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	94034903	139034903	Rat
1578673	Bmd13	Bone mineral density QTL 13	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	5	69474415	114474415	Rat
1358909	Kidm25	Kidney mass QTL 25	1.87		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	95062526	133270832	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	60601597	137492949	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	60511627	105511627	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	36460764	136631402	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	64589016	109589016	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	74335621	156302135	Rat
1600362	Mcs19	Mammary carcinoma susceptibility QTL 19	2.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	82032155	127032155	Rat
1298086	Bp156	Blood pressure QTL 156			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	89369373	134369373	Rat
2290005	Mcs24	Mammary carcinoma susceptibility QTL 24			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	69835120	114835120	Rat
2306971	Anxrr21	Anxiety related response QTL 21	9.47		fear/anxiety-related behavior trait (VT:1000241)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	5	70969494	136328156	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	97492524	133270832	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	56546393	101546393	Rat
2312671	Scl64	Serum cholesterol level QTL 64		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	73779642	118779642	Rat
6903316	Bw113	Body weight QTL 113	2	0.0103	body mass (VT:0001259)	body weight (CMO:0000012)	5	92881678	137881678	Rat
1358889	Bp261	Blood pressure QTL 261	2.86		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	95062526	133270832	Rat

Markers in Region

AV077978

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	5	100,455,350 - 100,455,432 (+)	Marker Load Pipeline
mRatBN7.2	5	95,409,310 - 95,409,391 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	98,514,998 - 98,515,078	NCBI	Rnor6.0
Rnor_5.0	5	102,558,656 - 102,558,736	UniSTS	Rnor5.0
RGSC_v3.4	5	99,646,913 - 99,646,993	UniSTS	RGSC3.4
Celera	5	93,981,913 - 93,981,993	UniSTS
Cytogenetic Map	5	q31	UniSTS

D4Bwg0951e

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	95,409,308 - 95,409,436 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	98,514,996 - 98,515,123	NCBI	Rnor6.0
Rnor_5.0	5	102,558,654 - 102,558,781	UniSTS	Rnor5.0
RGSC_v3.4	5	99,646,911 - 99,647,038	UniSTS	RGSC3.4
Celera	5	93,981,911 - 93,982,038	UniSTS
Cytogenetic Map	5	q31	UniSTS

AV175137

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	95,409,310 - 95,409,439 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	98,514,998 - 98,515,126	NCBI	Rnor6.0
Rnor_5.0	5	102,558,656 - 102,558,784	UniSTS	Rnor5.0
RGSC_v3.4	5	99,646,913 - 99,647,041	UniSTS	RGSC3.4
Celera	5	93,981,913 - 93,982,041	UniSTS
Cytogenetic Map	5	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	146	91	90	59	26	59	6	288	124	9	127	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025022	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017593479	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287940	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC091300	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473978	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000041374 ⟹ ENSRNOP00000045285

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	100,407,483 - 100,455,478 (+)	Ensembl
mRatBN7.2 Ensembl	5	95,362,005 - 95,409,438 (+)	Ensembl
Rnor_6.0 Ensembl	5	98,469,047 - 98,515,125 (+)	Ensembl

RefSeq Acc Id:

NM_001025022 ⟹ NP_001020193

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	100,408,040 - 100,455,479 (+)	NCBI
mRatBN7.2	5	95,362,005 - 95,409,439 (+)	NCBI
Rnor_6.0	5	98,469,047 - 98,515,126 (+)	NCBI
Rnor_5.0	5	102,512,705 - 102,558,784 (+)	NCBI
RGSC_v3.4	5	99,599,574 - 99,647,041 (+)	RGD
Celera	5	93,934,901 - 93,982,041 (+)	RGD

Sequence:

show sequence

CGGGGACCCAGGCCGGGCCCGGGGAGCCCAGTGCTGAGCTCTAGAGCCCGCCAGGCCGCCGCCT
CCTCGCGCCCTCTGCCTTTACTGTCAGTGTCGCCCCTCGCAAAGAGTCATGGAAGACGGTCCGC
TGCCAGATCTCAGAGACATCGAGCTGAAGCTGGGGCGCAAAGTGCCCGAGAGCCTAGCGCGCTC
GCTGCGCGGGGAGGAGCCGGCGCCCCGGGAAGGGGCTGCGGACCCCAGCGGGGTTGGTGGGAGC
TGCAGCAGCAGCAGTAGCTGCAGCAGCTTCGCGCCCTCCGTGTCCTCCTCGTCTTCATCCTCCC
CTGCCTCCGGCTCCCCACGACGTAGCCACCCCAGCGCCCTGGAGAGGCTAGAGACCAAACTGCA
CATCCTCAGGCAGGAGATGGTGAACCTCAGAGCCACTGACGTAAGGCTCATGCGTCAATTGCTC
CTCATCAATGAGAGCATCGAGTCCATCAAGTGGATGATTGAGGAAAAGGCCACCGTTACCAGCC
GAGGCAGCAGTCTCAGTGGCAGCCTGTGTAGTTTGCTGGAGAGTCAGAGCACCTCCTTACGTGG
CAGCTACAACAGCCTCCATGATGGCAGTGATGGGCTGGATGGCATCTCGGTAGGGAGCTACCTG
GACACTTTGGCAGATGATGTACCAGGCCATCAGACCCCTTCAGACTTGGATCAGTTCAGTGACA
GCTCTATCATAGAGGACTCTCAAGCTCTGCACAAGCATCCCAAGCTGGATTCTGAGTACTACTG
CTTTGGCTAATGATCCACGTTTTTGCATGGGACTGATGTGCAATTAACTTGTATGTATCCTTCT
TCTCTGCTGCTATATTTTTGGTGTGATTTATTTTAATAAGGCAACCTTTTTAAAGAAGCTTATT
TTTAAACTGCTTAATGAAATTTCTGTTGCTCCTAATACTTCTCATCTAGACTGATTTATTTTTC
TCTGTTACATCTCTATTTTTATTTATTGTAATAATCTTTCTCCCTTCTCTTACAGTAGCACAGA
CAAAGTAGAGGGGGAAAATAAGCAATAATTGTTTCTGCTTTTGTTTTCAGAGTGAGGGGTCAGG
GATTATATGAAACACTTTGCTAAGTTTTACAATAAACCAAAGTCTGATCACTTCCTTCAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063287940 ⟹ XP_063144010

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	100,402,921 - 100,455,479 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001020193	(Get FASTA)	NCBI Sequence Viewer
	XP_063144010	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH91300	(Get FASTA)	NCBI Sequence Viewer
	EDM10477	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000045285
GenBank Protein	Q5BJW5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001020193 ⟸ NM_001025022

- UniProtKB:

Q5BJW5 (UniProtKB/Swiss-Prot), A6J830 (UniProtKB/TrEMBL), A0A8L2QP13 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEDGPLPDLRDIELKLGRKVPESLARSLRGEEPAPREGAADPSGVGGSCSSSSSCSSFAPSVSS
SSSSSPASGSPRRSHPSALERLETKLHILRQEMVNLRATDVRLMRQLLLINESIESIKWMIEEK
ATVTSRGSSLSGSLCSLLESQSTSLRGSYNSLHDGSDGLDGISVGSYLDTLADDVPGHQTPSDL
DQFSDSSIIEDSQALHKHPKLDSEYYCFG

hide sequence

Ensembl Acc Id:

ENSRNOP00000045285 ⟸ ENSRNOT00000041374

RefSeq Acc Id:	XP_063144010 ⟸ XM_063287940
- Peptide Label:	isoform X1
- UniProtKB:	A0A8L2QP13 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5BJW5-F1-model_v2	AlphaFold	Q5BJW5	1-221	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308059	AgrOrtholog
BioCyc Gene	G2FUF-40916	BioCyc
Ensembl Genes	ENSRNOG00000033740	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000041374	ENTREZGENE
IMAGE_CLONE	IMAGE:7309480	IMAGE-MGC_LOAD
InterPro	LURA1/LRA25	UniProtKB/Swiss-Prot
	LURAP1	UniProtKB/Swiss-Prot
KEGG Report	rno:362535	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:109234	IMAGE-MGC_LOAD
NCBI Gene	362535	ENTREZGENE
PANTHER	LEUCINE RICH ADAPTOR PROTEIN 1-LIKE	UniProtKB/Swiss-Prot
	PTHR33767	UniProtKB/Swiss-Prot
Pfam	LURAP	UniProtKB/Swiss-Prot
PhenoGen	Lurap1l	PhenoGen
RatGTEx	ENSRNOG00000033740	RatGTEx
UniProt	A0A8L2QP13	ENTREZGENE, UniProtKB/TrEMBL
	A6J830	ENTREZGENE, UniProtKB/TrEMBL
	LUR1L_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-10-10	Lurap1l	leucine rich adaptor protein 1-like	RGD1308059	similar to DNA segment, Chr 4, Brigham & Womens Genetics 0951 expressed	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1308059	similar to DNA segment, Chr 4, Brigham & Womens Genetics 0951 expressed	RGD1308059_predicted	similar to DNA segment, Chr 4, Brigham & Womens Genetics 0951 expressed (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1308059_predicted	similar to DNA segment, Chr 4, Brigham & Womens Genetics 0951 expressed (predicted)	LOC362535_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC362535_predicted	similar to DNA segment, Chr 4, Brigham & Womens Genetics 0951 expressed (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD