Advanced Search (OLGA)

Gene: Psmb10 (proteasome 20S subunit beta 10) Rattus norvegicus

Analyze

Symbol:

Psmb10

Name:

proteasome 20S subunit beta 10

RGD ID:

1307428

Description:

Predicted to enable endopeptidase activity. Predicted to be involved in proteasome-mediated ubiquitin-dependent protein catabolic process. Predicted to act upstream of or within T cell proliferation and cell morphogenesis. Predicted to be located in cytoplasm. Predicted to be part of proteasome core complex, beta-subunit complex and spermatoproteasome complex. Predicted to be active in cytosol and nucleus. Human ortholog(s) of this gene implicated in immunodeficiency 121 and proteosome-associated autoinflammatory syndrome 5. Orthologous to human PSMB10 (proteasome 20S subunit beta 10); PARTICIPATES IN ubiquitin/proteasome degradation pathway; INTERACTS WITH 1,3-dinitrobenzene; 17alpha-ethynylestradiol; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC291983; low molecular mass protein 10; macropain subunit MECl-1; MGC112890; multicatalytic endopeptidase complex subunit MECl-1; proteasome (prosome, macropain) subunit, beta type 10; proteasome MECl-1; proteasome subunit beta 10; proteasome subunit beta type-10; proteasome subunit beta-2i

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PSMB10 (proteasome 20S subunit beta 10)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Psmb10 (proteasome (prosome, macropain) subunit, beta type 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Psmb10 (proteasome 20S subunit beta 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PSMB10 (proteasome 20S subunit beta 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PSMB10 (proteasome 20S subunit beta 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Psmb10 (proteasome 20S subunit beta 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PSMB10 (proteasome 20S subunit beta 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PSMB10 (proteasome 20S subunit beta 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Psmb10 (proteasome 20S subunit beta 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Psmb10 (proteasome 20S subunit beta 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PSMB10 (proteasome 20S subunit beta 10)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Psmb10 (proteasome (prosome, macropain) subunit, beta type 10)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	psmb13a (proteasome subunit beta 13a)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	psmb13a (proteasome subunit beta 13a)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PUP1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Prosbeta2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Prosbeta2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Prosbeta2R1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Prosbeta2R2	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	pbs-2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	psmb7.2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	psmb7.2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	50,740,808 - 50,743,292 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	50,740,811 - 50,743,210 (-)	Ensembl				GRCr8
mRatBN7.2	19	33,830,958 - 33,833,442 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	33,827,229 - 33,833,626 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	40,646,494 - 40,648,978 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	41,299,809 - 41,302,293 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	43,598,358 - 43,600,829 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	37,909,543 - 37,912,027 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	37,909,546 - 37,912,027 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	48,776,574 - 48,779,058 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	35,777,710 - 35,780,194 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	33,258,507 - 33,260,991 (-)	NCBI		Celera
RGSC_v3.1	19	35,763,530 - 35,785,075 (-)	NCBI
Cytogenetic Map	19	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Experimental Liver Cirrhosis (ISO)

human immunodeficiency virus infectious disease (ISO)

immunodeficiency 121 (ISO)

proteosome-associated autoinflammatory syndrome 5 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

1,3-dinitrobenzene (EXP)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

2,6-dinitrotoluene (EXP)

2-butoxyethanol (ISO)

2-hydroxypropanoic acid (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (EXP)

4-hydroxynon-2-enal (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrylamide (EXP)

Actein (EXP)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

antirheumatic drug (ISO)

Aroclor 1254 (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

buspirone (EXP)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

calcitriol (ISO)

cantharidin (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

clofibrate (ISO)

clofibric acid (EXP)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

D-glucose (ISO)

diethylstilbestrol (ISO)

disodium selenite (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

fenthion (ISO)

fipronil (EXP)

flutamide (EXP)

folic acid (ISO)

FR900359 (ISO)

fructose (ISO)

genistein (ISO)

gentamycin (EXP)

glucose (ISO)

glyphosate (ISO)

ionomycin (ISO)

isobutanol (ISO)

lactacystin (ISO)

lipopolysaccharide (ISO)

metacetamol (ISO)

methimazole (EXP)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

N-methyl-4-phenylpyridinium (EXP)

N-nitrosodiethylamine (EXP)

N-nitrosodimethylamine (EXP)

nickel atom (ISO)

nitrates (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

pentachlorophenol (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP,ISO)

phorbol 13-acetate 12-myristate (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

rac-lactic acid (ISO)

resveratrol (EXP)

rotenone (ISO)

salicylic acid (ISO)

SB 431542 (ISO)

selenium atom (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

sodium dodecyl sulfate (ISO)

sotorasib (ISO)

sulfadimethoxine (EXP)

tacrolimus hydrate (ISO)

temozolomide (ISO)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

theophylline (EXP)

thioacetamide (EXP)

tolfenamic acid (ISO)

toluene (EXP)

trametinib (ISO)

trichostatin A (ISO)

trimellitic anhydride (EXP)

triphenyl phosphate (ISO)

Triptolide (EXP)

trovafloxacin (EXP)

tunicamycin (ISO)

urethane (ISO)

valdecoxib (EXP)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell morphogenesis (ISO)

proteasome-mediated ubiquitin-dependent protein catabolic process (IBA)

proteolysis (IEA)

proteolysis involved in protein catabolic process (IEA)

T cell proliferation (ISO)

Cellular Component

cytoplasm (IEA)

cytosol (IBA)

nucleus (IBA,IEA)

proteasome complex (IEA)

proteasome core complex (IEA,ISO,ISS)

proteasome core complex, beta-subunit complex (IBA)

spermatoproteasome complex (IEA,ISO,ISS)

Molecular Function

endopeptidase activity (IBA)

hydrolase activity (IEA)

peptidase activity (IEA)

protein binding (ISO)

serine-type endopeptidase activity (IEA)

serine-type peptidase activity (IEA)

threonine-type endopeptidase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

ubiquitin/proteasome degradation pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15199151	PMID:16857966	PMID:17540904	PMID:18419753	PMID:23706739

Genomics

Comparative Map Data

Psmb10
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	50,740,808 - 50,743,292 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	50,740,811 - 50,743,210 (-)	Ensembl				GRCr8
mRatBN7.2	19	33,830,958 - 33,833,442 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	33,827,229 - 33,833,626 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	40,646,494 - 40,648,978 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	41,299,809 - 41,302,293 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	43,598,358 - 43,600,829 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	37,909,543 - 37,912,027 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	37,909,546 - 37,912,027 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	48,776,574 - 48,779,058 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	35,777,710 - 35,780,194 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	33,258,507 - 33,260,991 (-)	NCBI		Celera
RGSC_v3.1	19	35,763,530 - 35,785,075 (-)	NCBI
Cytogenetic Map	19	q12	NCBI

PSMB10
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	67,934,506 - 67,936,850 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	67,934,506 - 67,936,864 (-)	Ensembl			hg38	GRCh38
GRCh37	16	67,968,409 - 67,970,753 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	66,525,908 - 66,528,254 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	16	66,525,907 - 66,528,254	NCBI
Celera	16	52,476,864 - 52,479,210 (-)	NCBI		Celera
Cytogenetic Map	16	q22.1	NCBI
HuRef	16	53,841,977 - 53,844,350 (-)	NCBI		HuRef
CHM1_1	16	69,376,471 - 69,378,844 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	73,730,280 - 73,732,624 (-)	NCBI		T2T-CHM13v2.0

Psmb10
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	106,662,360 - 106,665,024 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	106,662,367 - 106,665,076 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	8	105,935,728 - 105,938,392 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	105,935,735 - 105,938,444 (-)	Ensembl			mm10	GRCm38
MGSCv37	8	108,459,628 - 108,462,292 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	8	108,824,893 - 108,827,234 (-)	NCBI		MGSCv36	mm8
Celera	8	110,163,776 - 110,166,440 (-)	NCBI		Celera
Cytogenetic Map	8	D3	NCBI
cM Map	8	53.06	NCBI

Psmb10
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955484	8,777,621 - 8,780,320 (+)	Ensembl
ChiLan1.0	NW_004955484	8,777,618 - 8,780,393 (+)	NCBI	ChiLan1.0	ChiLan1.0

PSMB10
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	77,461,054 - 77,463,374 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	83,372,482 - 83,374,805 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	48,275,764 - 48,278,108 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	67,663,344 - 67,666,359 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	67,663,344 - 67,666,359 (-)	Ensembl			panPan2	panpan1.1

PSMB10
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	81,560,750 - 81,563,571 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	81,561,056 - 81,563,564 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	81,551,024 - 81,553,555 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	81,996,365 - 81,998,896 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	81,996,380 - 81,998,889 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	81,822,575 - 81,825,106 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	81,504,707 - 81,507,236 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	82,146,923 - 82,149,454 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Psmb10
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	41,296,032 - 41,299,059 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936475	18,290,077 - 18,292,544 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936475	18,290,055 - 18,293,035 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PSMB10
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	28,543,972 - 28,548,152 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	28,544,910 - 28,547,609 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Pig Cytomap	6	p14-p15	NCBI

PSMB10
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	59,502,616 - 59,505,584 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	59,503,246 - 59,505,521 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666047	22,227,805 - 22,230,927 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Psmb10
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	18,442,478 - 18,445,731 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624746	18,442,865 - 18,445,731 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Psmb10
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	17	25,676,071 - 25,678,622 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Psmb10
6 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	30
Count of miRNA genes:	28
Interacting mature miRNAs:	30
Transcripts:	ENSRNOT00000026462
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	19220689	64220689	Rat
9590298	Uminl5	Urine mineral level QTL 5	3.59	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	19	7997750	52997750	Rat
724546	Kidm3	Kidney mass QTL 3	3.1		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	19	46226778	74246245	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	36289	74246245	Rat
2313395	Anxrr26	Anxiety related response QTL 26			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	19	44385134	74246245	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	32539615	74246245	Rat
1558656	Prcs1	Prostate cancer susceptibility QTL 1	5		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	19	31287532	51431640	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	31777888	74246245	Rat
9590090	Insglur8	Insulin/glucose ratio QTL 8	10.81	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	19	7997750	52997750	Rat
1554318	Bmd5	Bone mineral density QTL 5	12.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	19	23188586	68188586	Rat
1549835	Tcas7	Tongue tumor susceptibility QTL 7		0.001	tongue integrity trait (VT:0010553)	squamous cell carcinoma of the head and neck tumor number (CMO:0001876)	19	41722546	74246245	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2194317	74246245	Rat
1354633	Bw28	Body weight QTL 28	6.04		body mass (VT:0001259)	body weight (CMO:0000012)	19	40727092	54856850	Rat
8552935	Pigfal10	Plasma insulin-like growth factor 1 level QTL 10	5.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	19	7997750	52997750	Rat
631840	Niddm38	Non-insulin dependent diabetes mellitus QTL 38	3.86		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	19	10329076	74246245	Rat
1358200	Insglur2	Insulin/glucose ratio QTL 2	4.1		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	19	5748064	50748064	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	32365311	74246245	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	24093973	69093973	Rat
2303628	Vencon9	Ventilatory control QTL 9		0.005	respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	19	23188586	68188586	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10833618	74246245	Rat
9590250	Scort11	Serum corticosterone level QTL 11	23.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	7997750	52997750	Rat
1354607	Gmadr1	Adrenal mass QTL 1	5.83		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	19	40727092	54856850	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	20109306	65109306	Rat
1354600	Salc2	Saline consumption QTL 2	9.91	0.001	drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	19	40727092	54856850	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2194317	74246245	Rat

Markers in Region

RH129859

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	33,834,761 - 33,834,928 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	37,913,347 - 37,913,513	NCBI	Rnor6.0
Rnor_5.0	19	48,780,378 - 48,780,544	UniSTS	Rnor5.0
RGSC_v3.4	19	35,781,514 - 35,781,680	UniSTS	RGSC3.4
Celera	19	33,262,311 - 33,262,477	UniSTS
RH 3.4 Map	19	317.7	UniSTS
Cytogenetic Map	19	q12	UniSTS

BI281208

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	19	50,740,861 - 50,741,173 (+)	Marker Load Pipeline
mRatBN7.2	19	33,831,011 - 33,831,323 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	37,909,597 - 37,909,908	NCBI	Rnor6.0
Rnor_5.0	19	48,776,628 - 48,776,939	UniSTS	Rnor5.0
RGSC_v3.4	19	35,777,764 - 35,778,075	UniSTS	RGSC3.4
Celera	19	33,258,561 - 33,258,872	UniSTS
RH 3.4 Map	19	282.1	UniSTS
Cytogenetic Map	19	q12	UniSTS

Psmb10

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	19	50,741,192 - 50,741,894 (+)	Marker Load Pipeline
mRatBN7.2	19	33,831,342 - 33,832,044 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	37,909,928 - 37,910,629	NCBI	Rnor6.0
Rnor_5.0	19	48,776,959 - 48,777,660	UniSTS	Rnor5.0
RGSC_v3.4	19	35,778,095 - 35,778,796	UniSTS	RGSC3.4
Celera	19	33,258,892 - 33,259,593	UniSTS
Cytogenetic Map	19	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025637	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC121465	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC098835	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217478	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220117	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226463	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227456	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228226	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229295	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229779	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233484	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234080	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ235075	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000026361 ⟹ ENSRNOP00000026361

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	50,737,085 - 50,738,979 (-)	Ensembl
mRatBN7.2 Ensembl	19	33,827,229 - 33,829,140 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000026462 ⟹ ENSRNOP00000026462

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	50,740,811 - 50,743,178 (-)	Ensembl
mRatBN7.2 Ensembl	19	33,830,961 - 33,833,328 (-)	Ensembl
Rnor_6.0 Ensembl	19	37,909,546 - 37,912,027 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094899 ⟹ ENSRNOP00000094160

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	33,827,229 - 33,829,557 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000099054 ⟹ ENSRNOP00000091409

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	50,737,079 - 50,738,715 (-)	Ensembl
mRatBN7.2 Ensembl	19	33,827,229 - 33,833,626 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000134274 ⟹ ENSRNOP00000111501

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	50,740,811 - 50,743,210 (-)	Ensembl

RefSeq Acc Id:

NM_001025637 ⟹ NP_001020808

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	50,740,808 - 50,743,292 (-)	NCBI
mRatBN7.2	19	33,830,958 - 33,833,442 (-)	NCBI
Rnor_6.0	19	37,909,543 - 37,912,027 (-)	NCBI
Rnor_5.0	19	48,776,574 - 48,779,058 (-)	NCBI
RGSC_v3.4	19	35,777,710 - 35,780,194 (-)	RGD
Celera	19	33,258,507 - 33,260,991 (-)	RGD

Sequence:

show sequence

GCGACCCGAAAAGCCCCACAGAAGCCACGACAGACGCCTCTGCTCTGACTTTGCTTTTTAAATC
TGATCCACCCATCGAGACCCCCGCATCTCAGTTGGCCTTCCTGCCCGGAGATGCTGAAGCAGGC
AGTGGAACACAGAGGAGGCTTCTCTTTCGAGAACTGCCAGAGGAATGCGTCCTTGGAACACGTC
CTTCCGGGACTTCGGGTCCCTCTTGCACGCAAGACCGGGACTACCATCGCCGGACTTGTGTTCC
GTGATGGAGTCATCCTGGGTGCGGACACGCGGGCTACTAACGATTCGGTTGTGGCGGATAAAAG
CTGCGAGAAGATCCACTTTATCGCCCCCAAAATCTACTGCTGTGGGGCTGGAGTAGCTGCGGAC
ACTGAGATGACCACGCGGATGGCAGCTTCCAAAATGGAACTACATGCTCTGTCCACCGGCCGTG
AACCTCGAGTGGCCACGGTCACCCGTATCTTGCGTCAGACGCTCTTCCGGTACCAAGGCCACGT
GGGAGCATCATTGATCGTGGGCGGGGTTGATTTGAACGGACCGCAGCTCTACAGCGTGCACCCA
CACGGTTCCTACAGCCGTCTGCCTTTTACTGCCCTTGGCTCTGGTCAGGATGCAGCCGTGGCAC
TGTTGGAGGACCGGTTCCAGCCAAACATGACGCTGGAGGCCGCGCAAGAGCTGTTGGTGGAAGC
CATCACAGCAGGGATCCTGGGTGACCTAGGCTCTGGAGGCAGTGTGGATGCCTGTGTGATCACT
GCAGGAGGCGCCAAACTGCAGAGAGCTTTGAGCTCACCCATAGAGCCTGTGCAGAGAGCTGGCC
AGTACCGCTTTGCTCCTGGAACCACACCTGTCCAGACCCAGGAAGTGAGAGCTCTGACCCTGGA
ACTTCTGGAGGAAACTGTGCAGGCTATGGAGGTGGAGTAAAGTGGCCTAAGATGTAGAGTTTGG
AACAAGGGTGAATAAATCCAGGAGATACAAACACTTAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001020808	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH98835	(Get FASTA)	NCBI Sequence Viewer
	EDL92421	(Get FASTA)	NCBI Sequence Viewer
	EDL92422	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000026462
GenBank Protein	Q4KM35	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001020808 ⟸ NM_001025637

- UniProtKB:

Q4KM35 (UniProtKB/Swiss-Prot), A6IYU3 (UniProtKB/TrEMBL), A0A8L2UK72 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLKQAVEHRGGFSFENCQRNASLEHVLPGLRVPLARKTGTTIAGLVFRDGVILGADTRATNDSV
VADKSCEKIHFIAPKIYCCGAGVAADTEMTTRMAASKMELHALSTGREPRVATVTRILRQTLFR
YQGHVGASLIVGGVDLNGPQLYSVHPHGSYSRLPFTALGSGQDAAVALLEDRFQPNMTLEAAQE
LLVEAITAGILGDLGSGGSVDACVITAGGAKLQRALSSPIEPVQRAGQYRFAPGTTPVQTQEVR
ALTLELLEETVQAMEVE

hide sequence

Ensembl Acc Id:

ENSRNOP00000026462 ⟸ ENSRNOT00000026462

Ensembl Acc Id:

ENSRNOP00000091409 ⟸ ENSRNOT00000099054

Ensembl Acc Id:

ENSRNOP00000026361 ⟸ ENSRNOT00000026361

Ensembl Acc Id:

ENSRNOP00000094160 ⟸ ENSRNOT00000094899

Ensembl Acc Id:

ENSRNOP00000111501 ⟸ ENSRNOT00000134274

Protein Domains

Proteasome beta subunit C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4KM35-F1-model_v2	AlphaFold	Q4KM35	1-273	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701094

Promoter ID:

EPDNEW_R11618

Type:

multiple initiation site

Name:

Psmb10_1

Description:

proteasome subunit beta 10

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	19	37,912,032 - 37,912,092	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307428	AgrOrtholog
BioCyc Gene	G2FUF-5800	BioCyc
Ensembl Genes	ENSRNOG00000019353	Ensembl
	ENSRNOG00000019494	Ensembl
	ENSRNOG00000078638	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000026462	ENTREZGENE
Gene3D-CATH	3.60.20.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7378841	IMAGE-MGC_LOAD
InterPro	Ntn_hydrolases_N	UniProtKB/Swiss-Prot
	Pept_T1A_subB	UniProtKB/Swiss-Prot
	Proteasome_bsu_C	UniProtKB/Swiss-Prot
	Proteasome_bsu_CS	UniProtKB/Swiss-Prot
	Proteasome_sua/b	UniProtKB/Swiss-Prot
	Proteasome_suB-type	UniProtKB/Swiss-Prot
KEGG Report	rno:291983	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:112890	IMAGE-MGC_LOAD
NCBI Gene	291983	ENTREZGENE
PANTHER	METALLOPROTEASE TLDD	UniProtKB/Swiss-Prot
	PROTEASOME SUBUNIT BETA TYPE-7	UniProtKB/Swiss-Prot
Pfam	Pr_beta_C	UniProtKB/Swiss-Prot
	Proteasome	UniProtKB/Swiss-Prot
PhenoGen	Psmb10	PhenoGen
PRINTS	PROTEASOME	UniProtKB/Swiss-Prot
PROSITE	PROTEASOME_BETA_1	UniProtKB/Swiss-Prot
	PROTEASOME_BETA_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000019353	RatGTEx
	ENSRNOG00000019494	RatGTEx
	ENSRNOG00000078638	RatGTEx
Superfamily-SCOP	SSF56235	UniProtKB/Swiss-Prot
UniProt	A0A8I6AFJ4_RAT	UniProtKB/TrEMBL
	A0A8L2UK72	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LKJ9_RAT	UniProtKB/TrEMBL
	A6IYU3	ENTREZGENE, UniProtKB/TrEMBL
	A6IYU4_RAT	UniProtKB/TrEMBL
	PSB10_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-09-13	Psmb10	proteasome 20S subunit beta 10	Psmb10	proteasome subunit beta 10	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-08-19	Psmb10	proteasome subunit beta 10	Psmb10	proteasome (prosome, macropain) subunit, beta type 10	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Psmb10	proteasome (prosome, macropain) subunit, beta type 10	Psmb10_predicted	proteasome (prosome, macropain) subunit, beta type 10 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Psmb10_predicted	proteasome (prosome, macropain) subunit, beta type 10 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)