Advanced Search (OLGA)

Gene: Nudcd2 (NudC domain containing 2) Rattus norvegicus

Analyze

Symbol:

Nudcd2

Name:

NudC domain containing 2

RGD ID:

1307203

Description:

Predicted to enable unfolded protein binding activity. Predicted to be involved in protein folding. Predicted to be located in centrosome; kinetochore; and spindle pole. Predicted to be active in cytoplasm. Orthologous to human NUDCD2 (NudC domain containing 2); INTERACTS WITH 2,4-dinitrotoluene; 2,6-dinitrotoluene; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

hypothetical LOC287199; LOC287199; MGC109498; nudC domain-containing protein 2; RGD1307203

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NUDCD2 (NudC domain containing 2)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther, PhylomeDB
Mus musculus (house mouse):	Nudcd2 (NudC domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nudcd2 (NudC domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NUDCD2 (NudC domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NUDCD2 (NudC domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nudcd2 (NudC domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NUDCD2 (NudC domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NUDCD2 (NudC domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nudcd2 (NudC domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Nudcd2 (NudC domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	STAT3 (signal transducer and activator of transcription 3)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	NUDCD2 (NudC domain containing 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Nudcd2 (NudC domain containing 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nudcd2 (NudC domain containing 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	nudcd2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	nudcd2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	25,665,493 - 25,671,010 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	25,665,509 - 25,682,902 (+)	Ensembl				GRCr8
mRatBN7.2	10	25,163,247 - 25,168,738 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	25,163,220 - 25,168,738 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	29,925,615 - 29,931,099 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	29,414,142 - 29,419,626 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	24,900,803 - 24,906,287 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	25,890,943 - 25,896,432 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	25,890,943 - 25,896,432 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	25,741,115 - 25,746,616 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	25,763,129 - 25,768,887 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	24,722,652 - 24,728,139 (+)	NCBI		Celera
RGSC_v3.1	10	25,764,177 - 25,769,934 (+)	NCBI
Cytogenetic Map	10	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-acetamidofluorene (ISO)

2-hydroxypropanoic acid (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (EXP,ISO)

alpha-Zearalanol (EXP)

amitrole (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP)

carbon nanotube (ISO)

chromium(6+) (ISO)

clotrimazole (EXP)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

dicrotophos (ISO)

ethanol (ISO)

formaldehyde (ISO)

indometacin (ISO)

inulin (ISO)

ivermectin (ISO)

kainic acid (ISO)

menadione (ISO)

methyl methanesulfonate (ISO)

N-nitrosodiethylamine (ISO)

oxaliplatin (EXP)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

quercetin (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

rotenone (ISO)

SB 431542 (ISO)

sodium arsenite (EXP,ISO)

sunitinib (ISO)

temozolomide (ISO)

tetrachloromethane (ISO)

thiram (ISO)

topotecan (EXP)

trimellitic anhydride (ISO)

tungsten (ISO)

valproic acid (ISO)

zearalenone (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

protein folding (IBA)

Cellular Component

centrosome (IEA)

cytoplasm (IBA)

kinetochore (IEA)

microtubule cytoskeleton (IEA,ISO)

mitotic spindle (IEA,ISO)

spindle pole (IEA)

Molecular Function

protein binding (ISO)

unfolded protein binding (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15489334	PMID:23376485

Genomics

Comparative Map Data

Nudcd2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	25,665,493 - 25,671,010 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	25,665,509 - 25,682,902 (+)	Ensembl				GRCr8
mRatBN7.2	10	25,163,247 - 25,168,738 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	25,163,220 - 25,168,738 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	29,925,615 - 29,931,099 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	29,414,142 - 29,419,626 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	24,900,803 - 24,906,287 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	25,890,943 - 25,896,432 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	25,890,943 - 25,896,432 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	25,741,115 - 25,746,616 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	25,763,129 - 25,768,887 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	24,722,652 - 24,728,139 (+)	NCBI		Celera
RGSC_v3.1	10	25,764,177 - 25,769,934 (+)	NCBI
Cytogenetic Map	10	q12	NCBI

NUDCD2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	163,446,526 - 163,460,102 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	163,446,526 - 163,460,404 (-)	Ensembl			hg38	GRCh38
GRCh37	5	162,873,532 - 162,887,108 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	162,813,164 - 162,819,721 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	5	162,813,164 - 162,819,721	NCBI
Celera	5	158,914,701 - 158,921,251 (-)	NCBI		Celera
Cytogenetic Map	5	q34	NCBI
HuRef	5	157,980,278 - 157,986,828 (-)	NCBI		HuRef
CHM1_1	5	162,313,053 - 162,319,610 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	163,981,702 - 163,995,279 (-)	NCBI		T2T-CHM13v2.0

Nudcd2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	40,624,485 - 40,630,873 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	40,624,494 - 40,630,873 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	11	40,733,645 - 40,740,046 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	40,733,667 - 40,740,046 (+)	Ensembl			mm10	GRCm38
MGSCv37	11	40,547,144 - 40,553,548 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	11	40,577,091 - 40,583,467 (+)	NCBI		MGSCv36	mm8
Celera	11	44,585,696 - 44,592,094 (+)	NCBI		Celera
Cytogenetic Map	11	A5	NCBI
cM Map	11	24.41	NCBI

Nudcd2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955408	16,858,635 - 16,865,597 (-)	Ensembl
ChiLan1.0	NW_004955408	16,858,635 - 16,864,617 (-)	NCBI	ChiLan1.0	ChiLan1.0

NUDCD2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	158,622,395 - 158,633,296 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	156,763,567 - 156,772,842 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	158,824,457 - 158,837,185 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	165,607,045 - 165,613,947 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	165,607,128 - 165,613,954 (-)	Ensembl			panPan2	panpan1.1

NUDCD2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	47,787,146 - 47,793,325 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	47,787,371 - 47,793,323 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	47,680,315 - 47,686,411 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	48,218,104 - 48,224,233 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	48,218,321 - 48,228,997 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	48,001,281 - 48,007,403 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	48,159,565 - 48,165,651 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	48,679,386 - 48,685,536 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Nudcd2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	102,150,333 - 102,156,600 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936515	599,105 - 605,913 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936515	599,759 - 605,931 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NUDCD2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	60,332,492 - 60,346,593 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	16	60,332,140 - 60,341,722 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	16	65,172,608 - 65,181,588 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NUDCD2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	65,725,141 - 65,732,228 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	65,721,753 - 65,732,323 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666574	37,804 - 44,852 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nudcd2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624733	26,351,533 - 26,357,303 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624733	26,351,523 - 26,357,303 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Nudcd2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	9	23,668,559 - 23,673,935 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Nudcd2
35 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	81
Count of miRNA genes:	53
Interacting mature miRNAs:	64
Transcripts:	ENSRNOT00000004339
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15776754	60776754	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22931373	91127454	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6660923	73950353	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5893811	50893811	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1250554	64349221	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5893811	50893811	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	14653541	59653541	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15533012	73695498	Rat
634329	Pia15	Pristane induced arthritis QTL 15	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	24662123	73695339	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6877142	51877142	Rat
2293680	Bss40	Bone structure and strength QTL 40	5.66	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	10	1	35730538	Rat
7387235	Uae41	Urinary albumin excretion QTL 41	5.26	0.1874	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	10	1	30004247	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	19939207	64939207	Rat
61332	Eau3	Experimental allergic uveoretinitis QTL 3		0.004	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	18035782	63035782	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	922197	45922197	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	2103708	47103708	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5893811	50893811	Rat
2298495	Eae23	Experimental allergic encephalomyelitis QTL 23	16.93		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis duration (CMO:0001424)	10	16175525	61175525	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18668419	63668419	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	20110614	65110614	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38832698	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21833758	61843633	Rat
631531	Iresp2	Immunoglobin response QTL2	6.3		blood immunoglobulin E amount (VT:0002492)	serum immunoglobulin E level (CMO:0002101)	10	23422121	32490778	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5893811	50893811	Rat
631660	Hcar1	Hepatocarcinoma resistance QTL 1	3.4	0.0001	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	10	6661118	35509383	Rat
631532	Cm50	Cardiac mass QTL 50	6.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	18035782	63035782	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14991535	86964295	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5893811	50893811	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6864618	96620484	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	20110614	65110614	Rat

Markers in Region

RH138187

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	7	14,992,388 - 14,992,585 (+)	Marker Load Pipeline
mRatBN7.2	7	14,290,207 - 14,290,404 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	18,366,810 - 18,367,006	NCBI	Rnor6.0
Rnor_5.0	7	18,544,410 - 18,544,606	UniSTS	Rnor5.0
RGSC_v3.4	7	16,000,806 - 16,001,002	UniSTS	RGSC3.4
Celera	7	13,189,554 - 13,189,750	UniSTS
RH 3.4 Map	7	97.82	UniSTS
Cytogenetic Map	10	q12	UniSTS

BE098866

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	25,168,262 - 25,168,457 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	25,895,957 - 25,896,151	NCBI	Rnor6.0
Rnor_5.0	10	25,746,141 - 25,746,335	UniSTS	Rnor5.0
Celera	10	24,727,664 - 24,727,858	UniSTS
RH 3.4 Map	10	278.4	UniSTS
Cytogenetic Map	10	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	90	59	6	354	190	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001009621	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085371	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC088299	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216253	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000086814 ⟹ ENSRNOP00000069725

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	25,665,509 - 25,682,902 (+)	Ensembl
mRatBN7.2 Ensembl	10	25,163,220 - 25,168,738 (+)	Ensembl
Rnor_6.0 Ensembl	10	25,890,943 - 25,896,432 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111631 ⟹ ENSRNOP00000077894

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	25,163,242 - 25,168,736 (+)	Ensembl

RefSeq Acc Id:

NM_001009621 ⟹ NP_001009621

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	25,665,519 - 25,671,010 (+)	NCBI
mRatBN7.2	10	25,163,247 - 25,168,738 (+)	NCBI
Rnor_6.0	10	25,890,943 - 25,896,432 (+)	NCBI
Rnor_5.0	10	25,741,115 - 25,746,616 (+)	NCBI
RGSC_v3.4	10	25,763,129 - 25,768,887 (+)	RGD
Celera	10	24,722,652 - 24,728,139 (+)	RGD

Sequence:

show sequence

GAATTTTGGCGTCACACAGATTAAAAGATCGCCGGCACTTGTCTCCTTTGTTCCAGCGTCAGCG
TTCTTGGGATGTCAACAACTCTAGGCTGCCGGTTTTTCCCACCAGGTCTCGCGAGTGTCTTAAA
TGGGCTCTGAAAGGGAAAAATTTGAACACTCGGACACGCCGGGTTTGGACTCTTGCGCATGTGC
AGTGACCCCAAGGCGCGGAGGGCAAACCCTGAGTCGAGTCCCGCCGGTGTAGTGCTCTCCCGGA
GCAGTGTCCCTGCGTGGCATCTTCAGAATGTCTGCCCCGTTTGAGGAGCGCAGCGGGGTAGTTC
CCTGCGCGACTCCGTGGGGACAGTGGTACCAGACCCTGGAGGAGGTGTTTATTGAAGTCCAGGT
GCCCCCGGGCACTCGCGCGCAGGACATCCAGTGTGGCCTGCAGAGTCGGCACGTGGCTCTGGCC
GTGGGTGGCCGCGAGATCCTCAAGGGGAAATTGTTTGACTCTACAATTGCTGATGAAGGAACAT
GGACTTTGGAGGATAGAAAGATGGTCCGCATCGTCCTGACAAAAACCAAGAGAGATGCTGCAAA
CTGTTGGACTTCCCTTCTAGAATCTGAATATGCAGCCGACCCCTGGGTGCAAGACCAAATGCAG
AGGAAACTTACGTTAGAGCGATTCCAGAAAGAGAATCCTGGGTTTGACTTTAGTGGAGCAGAAA
TCTCAGGGAACTACACAAAAGGTGGACCAGATTTCTCAAACCTTGAGAAATGACTGCTGTTGAG
TAGTTTCTGTCTGTCTGTCTGTCCGTGGATCCTGGCAGGTGCTGGCAACTTAATGCAGCTGATG
ATGTGACGGACGAGACACCCAATGTCTACAGTAAAAAGATTGCAAAGTGTATTTCAGTATGCTT
GTGAAAGATTACATTCAGATACGATTTGCGTAGGACATAGAGCAGCTCTGCTGTGGATAGATGG
TAACTTTTATTGCTCTGCATTAAGTTTTATATGCTACATTTTCCTAATTTCATATTTAATTGTA
TTTTTACTACAAAAACATTGGAGTACAAATCATATGAAATGAAAAGGTGCCTTCATGGAAAAAT
ATTTTTTTGTGTGTGTGTGATGCAAAAATAATGTTCAGTAAATTTCTGAGTAAGAATTGTGTAC
CCCTTTGTCTAGATATGCTTGTCTGTACACAGAAAGTACAGAACTGAAAATTTTTTTAAGAAAG
GAAAAAAGTACACTGAAATCCTTTGGATAACTTGAGTTAGTAAAAAATTCTAACTGGTTTGGTG
CTGCCTAAGTGATTATGTCAAGAAATTGAAAACTGATAAAACCCTAACAACATAAGAGAAGTTA
ATTGCCTCTTACTGTCAAAAAACAATTTAGGCCCCTGAGTGTAGGCCACAGGCTTCATTTAATT
TCAGTGATTCAGATAAAGTGGTCTGGAAAAAAAATTCTTTCATTTTCTTTGTGTTTTTTAAATC
TTGAAAAAAATCGAAATGTGTAAAAAGCTTACAAGTCAAATATTAACAGATTGAAATCTTACAC
TTTTTCTAATAAATTGACATGTTGTCACCTCAA

hide sequence

RefSeq Acc Id:

XM_039085371 ⟹ XP_038941299

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	25,665,493 - 25,671,010 (+)	NCBI
mRatBN7.2	10	25,163,681 - 25,168,738 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001009621	(Get FASTA)	NCBI Sequence Viewer
	XP_038941299	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88299	(Get FASTA)	NCBI Sequence Viewer
	EDM04114	(Get FASTA)	NCBI Sequence Viewer
	EDM04115	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000069725
	ENSRNOP00000077894.1
GenBank Protein	Q5M823	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001009621 ⟸ NM_001009621
- UniProtKB:	Q5M823 (UniProtKB/Swiss-Prot), A6HDK8 (UniProtKB/TrEMBL), A0A8L2R1N7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSAPFEERSGVVPCATPWGQWYQTLEEVFIEVQVPPGTRAQDIQCGLQSRHVALAVGGREILKG KLFDSTIADEGTWTLEDRKMVRIVLTKTKRDAANCWTSLLESEYAADPWVQDQMQRKLTLERFQ KENPGFDFSGAEISGNYTKGGPDFSNLEK hide sequence

Ensembl Acc Id:

ENSRNOP00000069725 ⟸ ENSRNOT00000086814

RefSeq Acc Id:	XP_038941299 ⟸ XM_039085371
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000077894 ⟸ ENSRNOT00000111631

Protein Domains

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5M823-F1-model_v2	AlphaFold	Q5M823	1-157	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697107

Promoter ID:

EPDNEW_R7632

Type:

initiation region

Name:

Nudcd2_1

Description:

NudC domain containing 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R7633

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	25,890,933 - 25,890,993	EPDNEW

RGD ID:

13697108

Promoter ID:

EPDNEW_R7633

Type:

initiation region

Name:

Nudcd2_2

Description:

NudC domain containing 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R7632

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	25,891,185 - 25,891,245	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307203	AgrOrtholog
BioCyc Gene	G2FUF-25491	BioCyc
Ensembl Genes	ENSRNOG00000060914	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000086814	ENTREZGENE
	ENSRNOT00000111631.1	UniProtKB/Swiss-Prot
Gene3D-CATH	2.60.40.790	UniProtKB/Swiss-Prot
	Single helix bin	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7323100	IMAGE-MGC_LOAD
InterPro	CS_dom	UniProtKB/Swiss-Prot
	HSP20-like_chaperone	UniProtKB/Swiss-Prot
	NudC_fam	UniProtKB/Swiss-Prot
	p23_NUDCD2	UniProtKB/Swiss-Prot
KEGG Report	rno:287199	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:109498	IMAGE-MGC_LOAD
NCBI Gene	287199	ENTREZGENE
PANTHER	NUDC DOMAIN-CONTAINING PROTEIN 2	UniProtKB/Swiss-Prot
	PTHR12356	UniProtKB/Swiss-Prot
Pfam	PF04969	UniProtKB/Swiss-Prot
PhenoGen	Nudcd2	PhenoGen
PROSITE	PS51203	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000060914	RatGTEx
Superfamily-SCOP	SSF49764	UniProtKB/Swiss-Prot
UniProt	A0A8L2R1N7	ENTREZGENE, UniProtKB/TrEMBL
	A6HDK8	ENTREZGENE, UniProtKB/TrEMBL
	A6HDK9_RAT	UniProtKB/TrEMBL
	NUDC2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Nudcd2	NudC domain containing 2	RGD1307203	hypothetical LOC287199	Symbol and Name updated	1299863	APPROVED
2005-12-06	RGD1307203	hypothetical LOC287199	RGD1307203_predicted	hypothetical LOC287199 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1307203_predicted	hypothetical LOC287199 (predicted)	LOC287199_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC287199_predicted	hypothetical LOC287199 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message