Advanced Search (OLGA)

Gene: Spin1 (spindlin 1) Rattus norvegicus

Analyze

Symbol:

Spin1 (Ensembl: LOC120097510)

Name:

spindlin 1 (Ensembl:spindlin-1-like)

RGD ID:

1306210

Description:

Predicted to enable histone H3K4me3 reader activity. Predicted to be involved in several processes, including positive regulation of Wnt signaling pathway; rRNA transcription; and regulation of gene expression. Predicted to be located in nucleolus and spindle. Predicted to be active in chromatin; cytosol; and nucleoplasm. Orthologous to human SPIN1 (spindlin 1); PARTICIPATES IN histone modification pathway; INTERACTS WITH 17alpha-ethynylestradiol; 3-chloropropane-1,2-diol; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC361217; NEWGENE_1306210; Spin; spindlin; spindlin-1; spindlin1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SPIN1 (spindlin 1)	RGD	RGD
Mus musculus (house mouse):	Spin1 (spindlin 1)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Spin1 (spindlin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SPIN1 (spindlin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SPIN1 (spindlin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Spin1 (spindlin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SPIN1 (spindlin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SPIN1 (spindlin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Spin1 (spindlin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Spin1 (spindlin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	SPIN1 (spindlin 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SPIN1 (spindlin 1)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Spin1 (spindlin 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Spin1 (spindlin 1)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	spin1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	spin1	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	14,207,384 - 14,257,330 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	14,207,384 - 14,257,190 (-)	Ensembl				GRCr8
mRatBN7.2	17	14,055,685 - 14,105,366 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	14,055,689 - 14,105,411 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	13,984,497 - 14,030,225 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	15,589,742 - 15,635,421 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	13,911,319 - 13,957,038 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	884,854 - 930,527 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	884,861 - 930,527 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	16,148,547 - 16,195,282 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	19,950,350 - 19,996,991 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	16	203,774 - 204,818 (-)	NCBI		Celera
RGSC_v3.1	17	19,950,350 - 19,996,991 (-)	NCBI
Cytogenetic Map	17	p14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP)

17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4,4'-trichlorobiphenyl (ISO)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4-hydroxyphenyl retinamide (ISO)

acrolein (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[b]fluoranthene (ISO)

benzo[e]pyrene (ISO)

beta-naphthoflavone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

chrysene (ISO)

clofibrate (ISO)

copper(II) sulfate (ISO)

dexamethasone (ISO)

dioxygen (ISO)

ethanol (ISO)

folic acid (ISO)

fulvestrant (ISO)

genistein (ISO)

hydrogen peroxide (ISO)

indometacin (ISO)

inulin (ISO)

leflunomide (EXP)

methapyrilene (ISO)

methidathion (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

PCB138 (ISO)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

rotenone (EXP,ISO)

silver atom (ISO)

silver(0) (ISO)

tetrachloromethane (ISO)

tetraphene (ISO)

thioacetamide (EXP)

thiram (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

chromatin organization (IEA)

gamete generation (IEA)

meiotic cell cycle (IEA)

positive regulation of DNA-templated transcription (ISO,ISS)

positive regulation of Wnt signaling pathway (ISO,ISS)

protein localization to chromatin (ISO,ISS)

regulation of DNA-templated transcription (IBA)

rRNA transcription (ISO,ISS)

transposable element silencing by piRNA-mediated DNA methylation (ISO,ISS)

Wnt signaling pathway (IEA)

Cellular Component

chromatin (ISO,ISS)

cytosol (IBA)

nucleolus (IEA,ISO,ISS)

nucleoplasm (IBA,ISO)

nucleus (IEA,ISO,ISS)

spindle (ISO)

Molecular Function

DNA binding (IEA)

histone H3K4me3 reader activity (ISO,ISS)

histone reader activity (ISO,ISS)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

histone modification pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Tudor: a versatile family of histone methylation 'readers'.	Lu R and Wang GG, Trends Biochem Sci. 2013 Nov;38(11):546-55. doi: 10.1016/j.tibs.2013.08.002. Epub 2013 Sep 10.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:9053325	PMID:9590541	PMID:12477932	PMID:15489334	PMID:21029866	PMID:21960006	PMID:23077255	PMID:24589551	PMID:29061846	PMID:31378911

Genomics

Comparative Map Data

Spin1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	14,207,384 - 14,257,330 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	14,207,384 - 14,257,190 (-)	Ensembl				GRCr8
mRatBN7.2	17	14,055,685 - 14,105,366 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	14,055,689 - 14,105,411 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	13,984,497 - 14,030,225 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	15,589,742 - 15,635,421 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	13,911,319 - 13,957,038 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	884,854 - 930,527 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	884,861 - 930,527 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	16,148,547 - 16,195,282 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	19,950,350 - 19,996,991 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	16	203,774 - 204,818 (-)	NCBI		Celera
RGSC_v3.1	17	19,950,350 - 19,996,991 (-)	NCBI
Cytogenetic Map	17	p14	NCBI

SPIN1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	88,388,444 - 88,478,694 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	88,387,434 - 88,480,234 (+)	Ensembl			hg38	GRCh38
GRCh37	9	91,003,359 - 91,093,609 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	90,193,117 - 90,283,443 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	9	88,232,968 - 88,320,261	NCBI
Celera	9	61,579,528 - 61,669,853 (+)	NCBI		Celera
Cytogenetic Map	9	q22.1	NCBI
HuRef	9	60,869,908 - 60,922,040 (+)	NCBI		HuRef
CHM1_1	9	91,150,928 - 91,241,252 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	100,542,547 - 100,632,795 (+)	NCBI		T2T-CHM13v2.0

Spin1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	51,254,523 - 51,306,588 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	51,254,916 - 51,306,582 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	13	51,097,934 - 51,152,562 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	51,100,880 - 51,152,546 (+)	Ensembl			mm10	GRCm38
MGSCv37	13	51,196,267 - 51,247,915 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	13	51,113,395 - 51,165,043 (+)	NCBI		MGSCv36	mm8
Celera	13	52,196,100 - 52,225,469 (+)	NCBI		Celera
Cytogenetic Map	13	A5	NCBI
cM Map	13	26.04	NCBI

Spin1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955515	3,470,956 - 3,513,728 (-)	Ensembl
ChiLan1.0	NW_004955515	3,470,956 - 3,518,909 (-)	NCBI	ChiLan1.0	ChiLan1.0

SPIN1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	50,992,872 - 51,087,039 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	50,995,264 - 51,089,744 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	59,466,550 - 59,558,773 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	87,513,819 - 87,606,187 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	87,513,819 - 87,606,183 (+)	Ensembl			panPan2	panpan1.1

SPIN1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	97,353,108 - 97,426,563 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	97,356,125 - 97,390,646 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	97,815,602 - 97,890,611 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	97,964,655 - 98,039,704 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	97,965,031 - 98,038,858 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	97,592,282 - 97,667,272 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	97,311,443 - 97,386,464 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	98,069,975 - 98,144,932 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Spin1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404944	10,187,095 - 10,254,730 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936854	448,296 - 516,355 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936854	448,403 - 516,251 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SPIN1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	227,209 - 294,826 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	227,219 - 291,420 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	418,141 - 534,760 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SPIN1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	98,880,918 - 98,964,988 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	98,913,798 - 98,960,934 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666038	87,213,604 - 87,297,382 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Spin1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624765	24,222,380 - 24,271,046 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624765	24,223,499 - 24,271,049 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Spin1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	14	69,494,165 - 69,544,662 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Spin1
456 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	15
Count of miRNA genes:	15
Interacting mature miRNAs:	15
Transcripts:	ENSRNOT00000014787
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	43999106	Rat
2300002	Iddm36	Insulin dependent diabetes mellitus QTL 36	1.98		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	17	9266755	40968173	Rat
2293664	Bmd28	Bone mineral density QTL 28	5.1	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	17	4360057	27233623	Rat
8552966	Pigfal18	Plasma insulin-like growth factor 1 level QTL 18	8.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	12860942	57860942	Rat
1300123	Bp194	Blood pressure QTL 194	2.82		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	2120843	42054133	Rat
1582224	Epfw4	Epididymal fat weight QTL 4	3.5	0.0058	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	17	9206505	23859062	Rat
1582225	Bw67	Body weight QTL 67	6.2	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	17	9206505	23859062	Rat
2302377	Scl61	Serum cholesterol level QTL 61	4.36		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	17	6221998	58177198	Rat
1582226	Bw64	Body weight QTL 64	4.2	0.0017	body mass (VT:0001259)	body weight (CMO:0000012)	17	9206505	23859062	Rat
9589151	Insul30	Insulin level QTL 30	8.82	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	12860942	57860942	Rat
10401807	Kidm52	Kidney mass QTL 52			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	17	1	31706603	Rat
10054088	Scort28	Serum corticosterone level QTL 28	2.04	0.0102	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	4733534	49733534	Rat
9589057	Scfw6	Subcutaneous fat weight QTL 6	8.62	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	17	12860942	57860942	Rat
1582208	Kidm32	Kidney mass QTL 32	3.9	0.0018	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	17	9206505	23859062	Rat
9590154	Scort9	Serum corticosterone level QTL 9	23.57	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	12860942	57860942	Rat
9590088	Insglur7	Insulin/glucose ratio QTL 7	20.38	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	17	12860942	57860942	Rat
1549900	Iddm20	Insulin dependent diabetes mellitus QTL 20	3.7		pancreas integrity trait (VT:0010560)	percentage of study population developing diabetes mellitus during a period of time (CMO:0001114)	17	1	22181410	Rat
2317053	Aia25	Adjuvant induced arthritis QTL 25	2.69		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	17	10604694	55604694	Rat
1354613	Kidm14	Kidney mass QTL 14	6.2		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	17	1	36045694	Rat
7411666	Foco31	Food consumption QTL 31	11.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	17	12860942	57860942	Rat
2324619	Coatc4	Coat color QTL 4		0.001	coat/hair pigmentation trait (VT:0010463)	pigmented dorsal coat/hair area to total dorsal coat/hair area ratio (CMO:0001811)	17	1	21499218	Rat
2303627	Vencon8	Ventilatory control QTL 8		0.001	respiration trait (VT:0001943)	tidal volume (CMO:0000222)	17	4733534	49733534	Rat
1581553	Pur14	Proteinuria QTL 14	5.3	0.0001	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	17	7985243	16523460	Rat
70184	BpQTLcluster14	Blood pressure QTL cluster 14	3.38		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	8574342	32199534	Rat
1582258	Bw76	Body weight QTL 76	4.6	0.0005	body mass (VT:0001259)	body weight (CMO:0000012)	17	9206505	23859062	Rat
631207	Niddm41	Non-insulin dependent diabetes mellitus QTL 41			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	17	1	38037084	Rat
1582199	Insul5	Insulin level QTL 5	3.4	0.0119	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	17	9206505	23859062	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	43999106	Rat
2293648	Bmd31	Bone mineral density QTL 31	4.5	0.0001	femur size trait (VT:1000369)	femoral neck cortical cross-sectional area (CMO:0001702)	17	4360057	27233623	Rat
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	43999106	Rat
1641902	Colcr7	Colorectal carcinoma resistance QTL 7	3.35	0.0044	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	17	2120843	22087569	Rat
1582241	Bw70	Body weight QTL 70	4.6	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	17	9206505	23859062	Rat
1582245	Bw73	Body weight QTL 73	4.6	0.0004	body mass (VT:0001259)	body weight (CMO:0000012)	17	9206505	23859062	Rat
9590316	Scort21	Serum corticosterone level QTL 21	4.75	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	1	22877318	Rat

Markers in Region

RH124326

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	104,592,140 - 104,592,589 (+)	MAPPER	mRatBN7.2
mRatBN7.2	16	217,250 - 217,699 (-)	MAPPER	mRatBN7.2
mRatBN7.2	2	148,724,497 - 148,724,942 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	109,317,489 - 109,317,937	NCBI	Rnor6.0
Rnor_6.0	2	155,282,443 - 155,282,887	NCBI	Rnor6.0
Rnor_5.0	2	174,676,861 - 174,677,305	UniSTS	Rnor5.0
Rnor_5.0	2	129,043,433 - 129,043,881	UniSTS	Rnor5.0
Cytogenetic Map	17	p14	UniSTS
Cytogenetic Map	2	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001024796	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001419143	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001419144	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001419145	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008771015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276559	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276560	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC097359	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473977	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000014787 ⟹ ENSRNOP00000014787

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	14,059,097 - 14,105,347 (-)	Ensembl
Rnor_6.0 Ensembl	16	884,861 - 930,527 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095885 ⟹ ENSRNOP00000088564

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	14,207,384 - 14,257,062 (-)	Ensembl
mRatBN7.2 Ensembl	17	14,055,689 - 14,090,596 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000106752 ⟹ ENSRNOP00000094195

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	14,207,384 - 14,257,190 (-)	Ensembl
mRatBN7.2 Ensembl	17	14,055,689 - 14,105,411 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000130321 ⟹ ENSRNOP00000100473

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	14,207,384 - 14,257,062 (-)	Ensembl

RefSeq Acc Id:

NM_001024796 ⟹ NP_001019967

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	14,207,384 - 14,256,507 (-)	NCBI
mRatBN7.2	17	14,055,685 - 14,104,811 (-)	NCBI
Rnor_6.0	16	884,856 - 930,527 (-)	NCBI
Rnor_5.0	17	16,148,547 - 16,195,282 (-)	NCBI
RGSC_v3.4	17	19,950,350 - 19,996,991 (-)	RGD
Celera	16	203,774 - 204,818 (-)	NCBI

Sequence:

show sequence

CTTGGGTTTGCCTCCCTGAATGCGCCGGATAGATGTGCGGTGCGGATACTGCGTAGCGCCGGGG
GTCGCGGTCCCTAGCGGCTTCCTGCACGGATGAGTGCTTGGGATTCCATGTGTTTTTGCTGAAC
TTGTAAAGGCGACACCTGGATGGTGGATTAACAAGAACACTGACCTGTGGGCAGCCTCAGCTGA
GAACATTGGATTTTTCACCCTAGTCCAGCAGCTCTGCTGCTCACATAGATGCAGATGAATGAAG
ACCCCATTCGGGAAGACACCTGGCCAGCGGTCCAGAGCTGATGCAGGCCATGCTGGAGTCTCTG
CAAACATGATGAAGAAGAGGACATCTCACAAAAAACATCGGACCAGTGTGGGACCAAGCAAACC
TGTGTCCCAGCCCCGGCGGAACATCGTAGGCTGCAGGATCCAGCATGGGTGGAGAGAGGGCAAC
GGCCCTGTCACCCAGTGGAAGGGGACTGTCCTGGACCAGGTGCCTGTGAACCCTTCCCTGTATC
TCATAAAGTACGATGGATTTGACTGTGTCTATGGACTAGAGCTGAACAAGGATGACAGAGTCTC
TGCACTTGAAGTCCTCCCTGACAGAGTTGCAACATCTCGGATTAGCGATGCACACTTAGCGGAC
ACAATGATTGGCAAAGCGGTGGAGCACATGTTTGAAACAGAGGATGGCTCTAAAGATGAGTGGA
GGGGGATGGTCTTGGCGCGGGCACCAGTCATGAACACATGGTTTTACATCACCTATGAGAAAGA
CCCTGTCTTGTACATGTACCAGCTCCTAGATGATTACAAAGAAGGCGACCTCCGCATTATGCCC
GATTCCAATGATTCGCCTCCAGCAGAAAGGGAGCCAGGAGAAGTTGTGGACAGCCTGGTAGGCA
AGCAAGTGGAATATGCCAAAGAAGACGGCTCGAAAAGGACTGGCATGGTCATCCATCAAGTAGA
GGCCAAGCCCTCTGTCTATTTCATCAAGTTTGATGACGACTTCCATATTTACGTCTACGATTTG
GTGAAAACATCCTAGATGTCATCACAAACTCTGCCAAATTTGTGGAACTATTAAATGTATAATT
TGTAGACATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NM_001419143 ⟹ NP_001406072

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	14,207,384 - 14,257,062 (-)	NCBI
mRatBN7.2	17	14,055,685 - 14,105,366 (-)	NCBI

RefSeq Acc Id:

NM_001419144 ⟹ NP_001406073

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	14,207,384 - 14,257,062 (-)	NCBI
mRatBN7.2	17	14,055,685 - 14,105,366 (-)	NCBI

RefSeq Acc Id:

NM_001419145 ⟹ NP_001406074

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	14,207,384 - 14,257,062 (-)	NCBI
mRatBN7.2	17	14,055,685 - 14,105,366 (-)	NCBI

RefSeq Acc Id:

XM_063276559 ⟹ XP_063132629

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	14,207,388 - 14,257,330 (-)	NCBI

RefSeq Acc Id:

XM_063276560 ⟹ XP_063132630

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	14,207,388 - 14,256,632 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001019967	(Get FASTA)	NCBI Sequence Viewer
	NP_001406072	(Get FASTA)	NCBI Sequence Viewer
	NP_001406073	(Get FASTA)	NCBI Sequence Viewer
	NP_001406074	(Get FASTA)	NCBI Sequence Viewer
	XP_063132629	(Get FASTA)	NCBI Sequence Viewer
	XP_063132630	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH97359	(Get FASTA)	NCBI Sequence Viewer
	EDL98095	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000088564
	ENSRNOP00000088564.1
	ENSRNOP00000100473
GenBank Protein	Q4V8J7	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001019967 ⟸ NM_001024796
- Peptide Label:	isoform 1
- UniProtKB:	Q4V8J7 (UniProtKB/Swiss-Prot), A6J6U6 (UniProtKB/TrEMBL), A0A8L2Q712 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRTSVGPSKPVSQPRRNIVGCRIQHGWRE GNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDDRVSALEVLPDRVATSRISDAHL ADTMIGKAVEHMFETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRI MPDSNDSPPAEREPGEVVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVY DLVKTS hide sequence

Ensembl Acc Id:

ENSRNOP00000014787 ⟸ ENSRNOT00000014787

Ensembl Acc Id:

ENSRNOP00000094195 ⟸ ENSRNOT00000106752

Ensembl Acc Id:

ENSRNOP00000088564 ⟸ ENSRNOT00000095885

RefSeq Acc Id:	NP_001406073 ⟸ NM_001419144
- Peptide Label:	isoform 2
- UniProtKB:	A0A8I6A4I2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	NP_001406074 ⟸ NM_001419145
- Peptide Label:	isoform 3
- UniProtKB:	A6J6U5 (UniProtKB/TrEMBL), A0A8I6AKH2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	NP_001406072 ⟸ NM_001419143
- Peptide Label:	isoform 1
- UniProtKB:	Q4V8J7 (UniProtKB/Swiss-Prot), A6J6U6 (UniProtKB/TrEMBL), A0A8L2Q712 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063132629 ⟸ XM_063276559
- Peptide Label:	isoform X1
- UniProtKB:	Q4V8J7 (UniProtKB/Swiss-Prot), A6J6U6 (UniProtKB/TrEMBL), A0A8L2Q712 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063132630 ⟸ XM_063276560
- Peptide Label:	isoform X1
- UniProtKB:	Q4V8J7 (UniProtKB/Swiss-Prot), A6J6U6 (UniProtKB/TrEMBL), A0A8L2Q712 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000100473 ⟸ ENSRNOT00000130321

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4V8J7-F1-model_v2	AlphaFold	Q4V8J7	1-262	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306210	AgrOrtholog
BioCyc Gene	G2FUF-10062	BioCyc
Ensembl Genes	ENSRNOG00000011119	Ensembl
	ENSRNOG00000067284	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000095885	ENTREZGENE
	ENSRNOT00000095885.1	UniProtKB/Swiss-Prot
	ENSRNOT00000130321	ENTREZGENE
Gene3D-CATH	2.80.10.70	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7442223	IMAGE-MGC_LOAD
InterPro	SPIN/Ssty	UniProtKB/Swiss-Prot
	SPIN/Ssty_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:361217	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:114391	IMAGE-MGC_LOAD
NCBI Gene	361217	ENTREZGENE
PANTHER	PTHR10405	UniProtKB/Swiss-Prot
Pfam	Spin-Ssty	UniProtKB/Swiss-Prot
PhenoGen	Spin1	PhenoGen
RatGTEx	ENSRNOG00000011119	RatGTEx
	ENSRNOG00000067284	RatGTEx
UniProt	A0A8I6A4I2	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AKH2	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6ALN2_RAT	UniProtKB/TrEMBL
	A0A8L2Q712	ENTREZGENE
	A0ABK0LHU6_RAT	UniProtKB/TrEMBL
	A6J6U5	ENTREZGENE, UniProtKB/TrEMBL
	A6J6U6	ENTREZGENE, UniProtKB/TrEMBL
	Q4V8J7	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Spin1	spindlin 1	NEWGENE_1306210	spindlin 1	Data merged from RGD:11436999	737654	PROVISIONAL
2016-08-02	NEWGENE_1306210	spindlin 1			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-03-07	Spin1	spindlin 1	Spin	spindlin	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Spin	spindlin	Spin_predicted	spindlin (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Spin_predicted	spindlin (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

RGD Manual Annotations