Advanced Search (OLGA)

Gene: Msrb2 (methionine sulfoxide reductase B2) Rattus norvegicus

Analyze

Symbol:

Msrb2

Name:

methionine sulfoxide reductase B2

RGD ID:

1306026

Description:

Predicted to enable actin binding activity; peptide-methionine (R)-S-oxide reductase activity; and zinc ion binding activity. Predicted to be involved in actin filament polymerization. Predicted to act upstream of or within protein repair. Predicted to be located in mitochondrion. Predicted to be active in cytoplasm. Orthologous to human MSRB2 (methionine sulfoxide reductase B2); PARTICIPATES IN glycine N-methyltransferase deficiency pathway; homocystinuria pathway; hypermethioninemia pathway; INTERACTS WITH 1,3-dinitrobenzene; acetamide; acrylamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC361286; methionine sulfoxide reductase B; methionine-R-sulfoxide reductase B2, mitochondrial; MGC114588; Mrsb

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MSRB2 (methionine sulfoxide reductase B2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Msrb2 (methionine sulfoxide reductase B2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Msrb2 (methionine sulfoxide reductase B2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MSRB2 (methionine sulfoxide reductase B2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MSRB2 (methionine sulfoxide reductase B2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Msrb2 (methionine sulfoxide reductase B2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MSRB2 (methionine sulfoxide reductase B2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MSRB2 (methionine sulfoxide reductase B2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Msrb2 (methionine sulfoxide reductase B2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Msrb2 (methionine sulfoxide reductase B2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	MSRB2 (methionine sulfoxide reductase B2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Msrb2 (methionine sulfoxide reductase B2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	msrb2 (methionine sulfoxide reductase B2)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F44E2.6	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F44E2.6	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	MXR2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector)
Saccharomyces cerevisiae (baker's yeast):	MXR2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	SelR	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	msrb2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	msrb2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	86,882,750 - 86,908,392 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	86,882,394 - 86,908,391 (+)	Ensembl				GRCr8
mRatBN7.2	17	81,974,378 - 82,000,044 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	81,974,196 - 82,000,043 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	85,439,480 - 85,465,090 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	89,274,912 - 89,300,521 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	83,291,676 - 83,317,287 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	86,066,841 - 86,148,131 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	86,066,833 - 86,148,130 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	87,781,867 - 87,860,121 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	93,416,941 - 93,442,773 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	17	81,244,664 - 81,270,209 (+)	NCBI		Celera
RGSC_v3.1	17	93,427,774 - 93,453,606 (+)	NCBI
Cytogenetic Map	17	q12.3	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

1,3-dinitrobenzene (EXP)

1,4-dithiothreitol (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

5-azacytidine (ISO)

acetamide (EXP)

acrylamide (EXP,ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

cocaine (EXP)

copper(II) sulfate (ISO)

curcumin (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

diethylstilbestrol (ISO)

dioxygen (EXP,ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

ethyl methanesulfonate (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

GSK-J4 (ISO)

indometacin (ISO)

inulin (ISO)

L-1,4-dithiothreitol (ISO)

menadione (ISO)

methoxychlor (EXP)

methylmercury chloride (ISO)

nefazodone (EXP)

nickel atom (ISO)

okadaic acid (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

salvianolic acid B (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium dodecyl sulfate (ISO)

tert-butyl hydroperoxide (ISO)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

thapsigargin (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

tunicamycin (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

actin filament polymerization (ISO,ISS)

protein repair (IEA,ISO)

response to oxidative stress (IEA)

Cellular Component

cytoplasm (IBA,IEA)

mitochondrion (IEA,ISO)

Molecular Function

actin binding (ISO,ISS)

L-methionine (R)-S-oxide reductase activity (IEA)

metal ion binding (IEA)

oxidoreductase activity (IEA)

oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor (IEA)

peptide-methionine (R)-S-oxide reductase activity (IBA,IEA,ISO,ISS)

zinc ion binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

glycine N-methyltransferase deficiency pathway (ISO)

homocystinuria pathway (ISO)

hypermethioninemia pathway (ISO)

methionine cycle/metabolic pathway (ISO)

methylenetetrahydrofolate reductase deficiency pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:14699060	PMID:18614015	PMID:23911929

Genomics

Comparative Map Data

Msrb2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	86,882,750 - 86,908,392 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	86,882,394 - 86,908,391 (+)	Ensembl				GRCr8
mRatBN7.2	17	81,974,378 - 82,000,044 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	81,974,196 - 82,000,043 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	85,439,480 - 85,465,090 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	89,274,912 - 89,300,521 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	83,291,676 - 83,317,287 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	86,066,841 - 86,148,131 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	86,066,833 - 86,148,130 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	87,781,867 - 87,860,121 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	93,416,941 - 93,442,773 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	17	81,244,664 - 81,270,209 (+)	NCBI		Celera
RGSC_v3.1	17	93,427,774 - 93,453,606 (+)	NCBI
Cytogenetic Map	17	q12.3	NCBI

MSRB2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	23,095,579 - 23,122,013 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	23,095,579 - 23,122,013 (+)	Ensembl			hg38	GRCh38
GRCh37	10	23,384,508 - 23,410,942 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	23,424,433 - 23,450,948 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	10	23,424,480 - 23,450,093	NCBI
Celera	10	23,072,080 - 23,098,540 (+)	NCBI		Celera
Cytogenetic Map	10	p12.2	NCBI
HuRef	10	23,053,143 - 23,070,958 (+)	NCBI		HuRef
CHM1_1	10	23,384,967 - 23,411,480 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	23,114,573 - 23,140,973 (+)	NCBI		T2T-CHM13v2.0

Msrb2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	19,376,247 - 19,399,787 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	19,376,251 - 19,399,787 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	19,371,436 - 19,394,976 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	19,371,440 - 19,394,976 (+)	Ensembl			mm10	GRCm38
MGSCv37	2	19,293,263 - 19,316,597 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	19,289,390 - 19,312,724 (+)	NCBI		MGSCv36	mm8
Celera	2	19,270,456 - 19,293,738 (+)	NCBI		Celera
Cytogenetic Map	2	A3	NCBI
cM Map	2	13.26	NCBI

Msrb2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955429	5,867,091 - 5,887,587 (-)	Ensembl
ChiLan1.0	NW_004955429	5,867,091 - 5,887,460 (-)	NCBI	ChiLan1.0	ChiLan1.0

MSRB2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	35,783,426 - 35,808,804 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	35,788,754 - 35,814,130 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	23,259,791 - 23,285,261 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	23,642,999 - 23,659,724 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2

MSRB2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	10,134,747 - 10,152,830 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	10,135,112 - 10,152,836 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	8,827,503 - 8,845,635 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	8,331,743 - 8,349,875 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	8,332,108 - 8,349,841 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	7,697,248 - 7,715,376 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	7,780,144 - 7,798,265 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	7,948,592 - 7,966,708 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Msrb2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	22,909,705 - 22,925,035 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936520	5,035,442 - 5,052,736 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MSRB2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	10	51,889,208 - 51,910,392 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	10	51,888,828 - 51,910,725 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	10	57,544,134 - 57,565,963 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MSRB2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	22,863,029 - 22,890,765 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	22,863,184 - 22,889,644 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666051	28,626,417 - 28,654,450 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Msrb2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624796	5,604,411 - 5,623,567 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624796	5,603,682 - 5,623,582 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Msrb2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	14	4,702,743 - 4,726,126 (-)	NCBI		Rrattus_CSIRO_v1

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	87
Count of miRNA genes:	73
Interacting mature miRNAs:	85
Transcripts:	ENSRNOT00000022661
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300131	Bp193	Blood pressure QTL 193	3.3		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	68550040	93515804	Rat
12904736	Cm121	Cardiac mass QTL 121		0.043	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	42388164	87388164	Rat
2301412	Kidm40	Kidney mass QTL 40		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	42388164	87388164	Rat
1300148	Bp192	Blood pressure QTL 192	3.47		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	17	46050126	91050126	Rat
1354588	Bvd4	Brain ventricular dilatation QTL 4	5.31	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	58194064	87388164	Rat
61466	Niddm12	Non-insulin dependent diabetes mellitus QTL 12	3.2	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	17	65154872	93515804	Rat
4889894	Eae33	Experimental allergic encephalomyelitis QTL 33	5.2	0.0001	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	17	55604597	93006569	Rat
2317038	Ginf3	Gastrointestinal inflammation QTL 3	2.89	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	17	54829503	93515804	Rat
2324621	Coatc5	Coat color QTL 5			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	17	42654895	87654895	Rat
2302365	Gluco40	Glucose level QTL 40	4.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	64569820	86954580	Rat
1598871	Memor5	Memory QTL 5	5.3		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	17	40968017	89341781	Rat

Markers in Region

RH132163

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	81,999,750 - 81,999,955 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	86,147,838 - 86,148,042	NCBI	Rnor6.0
Rnor_5.0	17	87,859,828 - 87,860,032	UniSTS	Rnor5.0
RGSC_v3.4	17	93,442,480 - 93,442,684	UniSTS	RGSC3.4
Celera	17	81,269,916 - 81,270,120	UniSTS
RH 3.4 Map	17	833.6	UniSTS
Cytogenetic Map	17	q12.3	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	164	91	90	59	90	59	6	354	190	11	143	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001031660	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429284	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429285	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039095963	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039095964	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276659	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276660	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276661	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276662	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC098953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473990	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000022661 ⟹ ENSRNOP00000022661

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	86,882,737 - 86,908,390 (+)	Ensembl
mRatBN7.2 Ensembl	17	81,974,389 - 82,000,040 (+)	Ensembl
Rnor_6.0 Ensembl	17	86,066,833 - 86,148,130 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095828 ⟹ ENSRNOP00000086902

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	86,882,394 - 86,908,391 (+)	Ensembl
mRatBN7.2 Ensembl	17	81,974,196 - 82,000,043 (+)	Ensembl

RefSeq Acc Id:

NM_001031660 ⟹ NP_001026830

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	86,882,752 - 86,908,392 (+)	NCBI
mRatBN7.2	17	81,974,398 - 82,000,044 (+)	NCBI
Rnor_6.0	17	86,066,841 - 86,148,131 (+)	NCBI
Rnor_5.0	17	87,781,867 - 87,860,121 (+)	NCBI
RGSC_v3.4	17	93,416,941 - 93,442,773 (+)	RGD
Celera	17	81,244,664 - 81,270,209 (+)	RGD

Sequence:

show sequence

CCCGTTGGTGGCAGAGTCATGGCGCGTCTGCTGCGAGCGCTGCGGGGTCTGCCTTGGCTGGAGG
CGCCTGGGCGAGCTCGGGGTTGCGCGGGATCGGGACGCGGGGACACAGGGTCTCTTATCAAGTC
CAAGCTCTCTCTAAGCAAGGCAGACTGGCAGAAGAAACTGACCCCTGAGCAATTCTACGTCACC
AGAGAGAAAGGAACTGAAGCGCCTTTCAGTGGAATGTATTTGAAAAACAAGGAGACAGGGATGT
ACCATTGCGTGTGCTGTGATAGCCCACTCTTCAGTTCTGAGAAGAAGTACTGTTCTGGCACCGG
TTGGCCTTCGTTTTCTGAGGCTCACGGCACCAAAGGCTCAGATGAAAGTCACACAGGGATCCTG
AGGCGCCTGGACACTTCCTTAGGATGTCCTCGCATGGAGGTGGTCTGCAAACAGTGTGAAGCTC
ACCTTGGCCATGTGTTTCCTGATGGACCCGATCCCACTGGACAAAGGTTTTGCATCAACAGCGT
GGCCCTGAAGTTCAAACCAAGCAAGCCCTGACTGTCTGCAGGGGGCCTGTGCTTTGCCCCTGCT
TGTGGAGCCACGGTTCTGTAATTCTGTTGAATCCCTTGCTTTAGTTGCTGAAAGTTTAGGTGAA
GGTTGTTCCTGGCCAACAGGGGAGTCAGAGCTTCTTAGTCACCTGACTTCCACTTGGGCTGTGG
GATTTCAACTGGCTGCCCAGACTCTGGGTGAGACCACAGGGTGGGACCCAGGCAGGATTTCCAC
GGGTTCATGGGCTGATGAGGGTTCCCAAAGCTCCTGAAGGGAACCTGAGTTGGCCATCTCGGTT
CATTCCTTCATGGGCGTATACAGATGAGGGCCCAAGGGGGAGAGAAAGGAACAGATGGGCTGGA
CCAGATGAGAGATCCCAGTGTTGGAGAGGAGGATGGGAGTGGCCGAGCATGGGAACACATTCAG
GGATGGATGAGTCTGTGGTTTCTTATCCAAAACTCCACTGACTCAACCTTAAAACTCACAAGTG
GGATCCATGCGGACTGAGTCAATCTGAGTGACTGTGAATAATGAATGCTCTCCCTCAACTCTTT
GTCACAACACTAAACTTCAAAATACTCAAATAAAATATTGAGGTCAATGTTTAAAAAAAAAAAA
AAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039095963 ⟹ XP_038951891

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	86,889,239 - 86,908,392 (+)	NCBI
mRatBN7.2	17	81,980,882 - 82,000,044 (+)	NCBI

RefSeq Acc Id:

XM_039095964 ⟹ XP_038951892

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	86,882,750 - 86,899,772 (+)	NCBI
mRatBN7.2	17	81,974,378 - 81,994,044 (+)	NCBI

RefSeq Acc Id:

XM_063276659 ⟹ XP_063132729

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	86,889,225 - 86,906,272 (+)	NCBI

RefSeq Acc Id:

XM_063276660 ⟹ XP_063132730

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	86,889,157 - 86,906,272 (+)	NCBI

RefSeq Acc Id:

XM_063276661 ⟹ XP_063132731

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	86,882,832 - 86,906,272 (+)	NCBI

RefSeq Acc Id:

XM_063276662 ⟹ XP_063132732

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	86,882,750 - 86,905,266 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001026830	(Get FASTA)	NCBI Sequence Viewer
	NP_001416213	(Get FASTA)	NCBI Sequence Viewer
	NP_001416214	(Get FASTA)	NCBI Sequence Viewer
	XP_038951891	(Get FASTA)	NCBI Sequence Viewer
	XP_038951892	(Get FASTA)	NCBI Sequence Viewer
	XP_063132729	(Get FASTA)	NCBI Sequence Viewer
	XP_063132730	(Get FASTA)	NCBI Sequence Viewer
	XP_063132731	(Get FASTA)	NCBI Sequence Viewer
	XP_063132732	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH98953	(Get FASTA)	NCBI Sequence Viewer
	EDL78778	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000022661
	ENSRNOP00000022661.4
GenBank Protein	Q4FZX5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001026830 ⟸ NM_001031660
- Peptide Label:	precursor
- UniProtKB:	Q4FZX5 (UniProtKB/Swiss-Prot), A6JMA1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MARLLRALRGLPWLEAPGRARGCAGSGRGDTGSLIKSKLSLSKADWQKKLTPEQFYVTREKGTE APFSGMYLKNKETGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTKGSDESHTGILRRLDTS LGCPRMEVVCKQCEAHLGHVFPDGPDPTGQRFCINSVALKFKPSKP hide sequence

Ensembl Acc Id:

ENSRNOP00000022661 ⟸ ENSRNOT00000022661

RefSeq Acc Id:	XP_038951892 ⟸ XM_039095964
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_038951891 ⟸ XM_039095963
- Peptide Label:	isoform X3

Ensembl Acc Id:

ENSRNOP00000086902 ⟸ ENSRNOT00000095828

RefSeq Acc Id:	XP_063132732 ⟸ XM_063276662
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063132731 ⟸ XM_063276661
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063132730 ⟸ XM_063276660
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063132729 ⟸ XM_063276659
- Peptide Label:	isoform X1

Protein Domains

MsrB

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4FZX5-F1-model_v2	AlphaFold	Q4FZX5	1-174	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700607

Promoter ID:

EPDNEW_R11130

Type:

initiation region

Name:

Msrb2_1

Description:

methionine sulfoxide reductase B2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	17	86,066,844 - 86,066,904	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306026	AgrOrtholog
BioCyc Gene	G2FUF-8529	BioCyc
Ensembl Genes	ENSRNOG00000016873	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000022661	ENTREZGENE
	ENSRNOT00000022661.7	UniProtKB/Swiss-Prot
Gene3D-CATH	Peptide methionine sulfoxide reductase	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7374871	IMAGE-MGC_LOAD
InterPro	Met_Sox_Rdtase	UniProtKB/Swiss-Prot
	Met_Sox_Rdtase_MsrB	UniProtKB/Swiss-Prot
	Mss4-like_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:361286	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:114588	IMAGE-MGC_LOAD
NCBI Gene	361286	ENTREZGENE
PANTHER	METHIONINE-R-SULFOXIDE REDUCTASE B2, MITOCHONDRIAL	UniProtKB/Swiss-Prot
	PTHR10173	UniProtKB/Swiss-Prot
Pfam	SelR	UniProtKB/Swiss-Prot
PhenoGen	Msrb2	PhenoGen
PROSITE	MSRB	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000016873	RatGTEx
Superfamily-SCOP	SSF51316	UniProtKB/Swiss-Prot
UniProt	A0A8I6A270_RAT	UniProtKB/TrEMBL
	A6JMA1	ENTREZGENE, UniProtKB/TrEMBL
	MSRB2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Msrb2	methionine sulfoxide reductase B2	Mrsb	methionine sulfoxide reductase B	Symbol and Name updated	1299863	APPROVED
2005-12-06	Mrsb	methionine sulfoxide reductase B	Mrsb_predicted	methionine sulfoxide reductase B (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Mrsb_predicted	methionine sulfoxide reductase B (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - SMPDB