Advanced Search (OLGA)

Gene: Ciao3 (cytosolic iron-sulfur assembly component 3) Rattus norvegicus

Analyze

Symbol:

Ciao3

Name:

cytosolic iron-sulfur assembly component 3

RGD ID:

1305982

Description:

Predicted to enable 4 iron, 4 sulfur cluster binding activity and metal ion binding activity. Predicted to be involved in several processes, including intracellular oxygen homeostasis; iron-sulfur cluster assembly; and response to hypoxia. Predicted to act upstream of or within hematopoietic progenitor cell differentiation. Predicted to be part of cytosolic [4Fe-4S] assembly targeting complex. Orthologous to human CIAO3 (cytosolic iron-sulfur assembly component 3); PARTICIPATES IN cytosolic iron-sulfur cluster protein assembly pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; furan.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

cytosolic Fe-S cluster assembly factor NARFL; IOP1; iron-only hydrogenase-like protein 1; LOC360496; MGC109005; Narfl; nuclear prelamin A recognition factor-like; nuclear prelamin A recognition factor-like protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CIAO3 (cytosolic iron-sulfur assembly component 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Ciao3 (cytosolic iron-sulfur assembly component 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ciao3 (cytosolic iron-sulfur assembly component 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CIAO3 (cytosolic iron-sulfur assembly component 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CIAO3 (cytosolic iron-sulfur assembly component 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ciao3 (cytosolic iron-sulfur assembly component 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CIAO3 (cytosolic iron-sulfur assembly component 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CIAO3 (cytosolic iron-sulfur assembly component 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ciao3 (cytosolic iron-sulfur assembly component 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ciao3 (cytosolic iron-sulfur assembly component 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	NARF (nuclear prelamin A recognition factor)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	CIAO3 (cytosolic iron-sulfur assembly component 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	CIAO3 (cytosolic iron-sulfur assembly component 3)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ciao3 (cytosolic iron-sulfur assembly component 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	narfl (nuclear prelamin A recognition factor-like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	narfl (nuclear prelamin A recognition factor-like)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG17683	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	NAR1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	oxy-4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	oxy-4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ciao3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	15,300,403 - 15,309,467 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	15,300,471 - 15,309,468 (+)	Ensembl				GRCr8
mRatBN7.2	10	14,795,888 - 14,804,953 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	14,795,961 - 14,804,950 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	19,535,018 - 19,543,954 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	19,023,897 - 19,032,831 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	14,524,003 - 14,532,951 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	10	18,224,816 - 18,233,751 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	10	18,886,450 - 18,895,389 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	10	20,578,132 - 20,587,071 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	10	20,563,894 - 20,572,833 (+)	NCBI		F344_StmMcwi
Rnor_6.0	10	15,143,732 - 15,152,706 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	15,143,713 - 15,153,396 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	14,956,675 - 14,965,649 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	15,041,376 - 15,050,350 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	14,464,975 - 14,473,945 (+)	NCBI		Celera
RGSC_v3.1	10	15,041,375 - 15,050,349 (+)	NCBI
Cytogenetic Map	10	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

hereditary hemorrhagic telangiectasia (ISO)

High Myopia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-palmitoylglycerol (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

acrolein (ISO)

acrylamide (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

arsane (ISO)

arsenic atom (ISO)

atrazine (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

folic acid (ISO)

fulvestrant (ISO)

furan (EXP)

gentamycin (EXP)

indometacin (ISO)

ketamine (EXP)

ozone (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

pyrimidifen (ISO)

rotenone (ISO)

sodium arsenite (ISO)

sodium dichromate (ISO)

thiram (ISO)

Triptolide (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

hematopoietic progenitor cell differentiation (ISO)

intracellular oxygen homeostasis (ISO)

iron-sulfur cluster assembly (ISO,ISS)

regulation of gene expression (ISO)

response to hypoxia (ISO)

Cellular Component

cytosolic [4Fe-4S] assembly targeting complex (IBA,ISO,ISS)

Molecular Function

4 iron, 4 sulfur cluster binding (IEA)

iron-sulfur cluster binding (IEA)

metal ion binding (IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

cytosolic iron-sulfur cluster protein assembly pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Iron-sulfur cluster biogenesis in mammalian cells: New insights into the molecular mechanisms of cluster delivery.	Maio N and Rouault TA, Biochim Biophys Acta. 2015 Jun;1853(6):1493-512. doi: 10.1016/j.bbamcr.2014.09.009. Epub 2014 Sep 19.
3.	Biogenesis of cytosolic and nuclear iron-sulfur proteins and their role in genome stability.	Paul VD and Lill R, Biochim Biophys Acta. 2015 Jun;1853(6):1528-39. doi: 10.1016/j.bbamcr.2014.12.018. Epub 2015 Jan 10.
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:16956324	PMID:18270200	PMID:21367862	PMID:22678361	PMID:22678362	PMID:23585563	PMID:24029230

Genomics

Comparative Map Data

Ciao3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	15,300,403 - 15,309,467 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	15,300,471 - 15,309,468 (+)	Ensembl				GRCr8
mRatBN7.2	10	14,795,888 - 14,804,953 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	14,795,961 - 14,804,950 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	19,535,018 - 19,543,954 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	19,023,897 - 19,032,831 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	14,524,003 - 14,532,951 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	10	18,224,816 - 18,233,751 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	10	18,886,450 - 18,895,389 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	10	20,578,132 - 20,587,071 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	10	20,563,894 - 20,572,833 (+)	NCBI		F344_StmMcwi
Rnor_6.0	10	15,143,732 - 15,152,706 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	15,143,713 - 15,153,396 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	14,956,675 - 14,965,649 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	15,041,376 - 15,050,350 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	14,464,975 - 14,473,945 (+)	NCBI		Celera
RGSC_v3.1	10	15,041,375 - 15,050,349 (+)	NCBI
Cytogenetic Map	10	q12	NCBI

CIAO3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	729,765 - 740,997 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	729,759 - 741,329 (-)	Ensembl			hg38	GRCh38
GRCh37	16	779,765 - 790,997 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	719,768 - 730,998 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	16	979,932 - 991,162 (-)	NCBI		Celera
Cytogenetic Map	16	p13.3	NCBI
HuRef	16	701,355 - 713,420 (-)	NCBI		HuRef
CHM1_1	16	779,737 - 790,967 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	733,939 - 745,171 (-)	NCBI		T2T-CHM13v2.0

Ciao3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	25,992,750 - 26,002,306 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	25,992,750 - 26,002,306 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	17	25,773,776 - 25,783,332 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	25,773,776 - 25,783,332 (+)	Ensembl			mm10	GRCm38
MGSCv37	17	25,910,721 - 25,920,277 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	17	25,501,400 - 25,510,932 (+)	NCBI		MGSCv36	mm8
Celera	17	26,306,378 - 26,316,138 (+)	NCBI		Celera
Cytogenetic Map	17	A3.3	NCBI
cM Map	17	12.88	NCBI

Ciao3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955442	16,465,178 - 16,475,110 (+)	Ensembl
ChiLan1.0	NW_004955442	16,465,759 - 16,475,110 (+)	NCBI	ChiLan1.0	ChiLan1.0

CIAO3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	970,394 - 981,690 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	4,754,231 - 4,765,546 (-)	NCBI		NHGRI_mPanPan1
PanPan1.1	16	742,818 - 754,087 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	742,818 - 754,087 (-)	Ensembl			panPan2	panpan1.1

CIAO3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	39,846,782 - 39,853,952 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	39,846,856 - 39,853,956 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	41,111,447 - 41,118,616 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	40,189,920 - 40,197,089 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	40,189,928 - 40,198,067 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	39,878,530 - 39,885,699 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	39,838,744 - 39,845,912 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	40,317,618 - 40,324,787 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ciao3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	112,179,668 - 112,189,069 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936501	277,518 - 286,932 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936501	277,525 - 286,929 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CIAO3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	41,042,702 - 41,050,012 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	3	41,042,672 - 41,050,013 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	41,427,901 - 41,435,243 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CIAO3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	649,457 - 661,085 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	650,100 - 660,518 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666068	30,475,095 - 30,486,224 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ciao3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624913	1,538,546 - 1,553,415 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624913	1,538,561 - 1,553,409 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ciao3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	9	3,039,241 - 3,048,122 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ciao3
35 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	199
Count of miRNA genes:	144
Interacting mature miRNAs:	157
Transcripts:	ENSRNOT00000026518
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5893811	50893811	Rat
631660	Hcar1	Hepatocarcinoma resistance QTL 1	3.4	0.0001	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	10	6661118	35509383	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6660923	73950353	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5893811	50893811	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1250554	64349221	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5893811	50893811	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14991535	86964295	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	14653541	59653541	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6877142	51877142	Rat
2293680	Bss40	Bone structure and strength QTL 40	5.66	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	10	1	35730538	Rat
7387235	Uae41	Urinary albumin excretion QTL 41	5.26	0.1874	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	10	1	30004247	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5893811	50893811	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6864618	96620484	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	922197	45922197	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	2103708	47103708	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5893811	50893811	Rat
631828	Alc5	Alcohol consumption QTL 5	2.4		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	1	17749933	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38832698	Rat

Markers in Region

RH131615

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	14,804,749 - 14,804,952 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	15,152,506 - 15,152,708	NCBI	Rnor6.0
Rnor_5.0	10	14,965,449 - 14,965,651	UniSTS	Rnor5.0
RGSC_v3.4	10	15,050,150 - 15,050,352	UniSTS	RGSC3.4
Celera	10	14,473,745 - 14,473,947	UniSTS
RH 3.4 Map	10	155.1	UniSTS
Cytogenetic Map	10	q12	UniSTS

BF391078

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	14,798,562 - 14,798,755 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	15,146,317 - 15,146,509	NCBI	Rnor6.0
Rnor_5.0	10	14,959,260 - 14,959,452	UniSTS	Rnor5.0
RGSC_v3.4	10	15,043,961 - 15,044,153	UniSTS	RGSC3.4
Celera	10	14,467,558 - 14,467,750	UniSTS
RH 3.4 Map	10	149.86	UniSTS
Cytogenetic Map	10	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	162	91	90	59	92	59	6	356	192	11	141	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001013183	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086275	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086276	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086277	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086278	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC091240	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000026518 ⟹ ENSRNOP00000026518

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	15,300,471 - 15,309,468 (+)	Ensembl
mRatBN7.2 Ensembl	10	14,795,961 - 14,804,950 (+)	Ensembl
Rnor_6.0 Ensembl	10	15,143,713 - 15,153,396 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000144894 ⟹ ENSRNOP00000108952

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	15,300,698 - 15,309,468 (+)	Ensembl

RefSeq Acc Id:

NM_001013183 ⟹ NP_001013201

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	15,300,493 - 15,309,467 (+)	NCBI
mRatBN7.2	10	14,795,978 - 14,804,950 (+)	NCBI
Dahl_SR_JrHsd	10	18,224,816 - 18,233,751 (+)	NCBI
Lyon_Normotensive	10	18,886,450 - 18,895,389 (+)	NCBI
Lyon_Hypertensive	10	20,578,132 - 20,587,071 (+)	NCBI
F344_StmMcwi	10	20,563,894 - 20,572,833 (+)	NCBI
Rnor_6.0	10	15,143,732 - 15,152,706 (+)	NCBI
Rnor_5.0	10	14,956,675 - 14,965,649 (+)	NCBI
RGSC_v3.4	10	15,041,376 - 15,050,350 (+)	RGD
Celera	10	14,464,975 - 14,473,945 (+)	RGD

Sequence:

show sequence

ATGGCGTCGCCCTTCAGTGGGGCACTACAGCTGACCGACCTGGATGACTTCATCGGGCCGTCTC
AGAGTTGCATCAAGCCGGTGACGGTGGCTAAGAAGCCTGGAAGTGGGATAGCCAAGATCCACAT
CGAAGATGATGGCAGTTACTTCCAAGTGAACCCAGATGGAAGAAGCCAGAAGCTGGAGAAGGCC
AAGGTCTCCCTGAACGACTGCCTGGCCTGCAGTGGCTGTGTCACTTCAGCAGAGACGATACTCA
TCACCCAGCAGAGTCACGAGGAACTGCGGAAGGTTCTAGATGCTAATAAGGTGGCAGCACCGGG
TCAGCAGCGGCTCGTGGTCGTGTCCGTCTCACCGCAGTCTAGAGCGTCACTGGCTGCCAGGTTT
CAGCTAGACTCCACAGACACCGCCAGGAAATTAACTTCATTCTTCAAAAAAATAGGGGTGCACT
TCGTCTTCGATACTGCCTTCGCAAGGAACTTCAGCCTTTTGGAGAGCCAGAAAGAGTTTGTGCA
GCGATTCCGAGAACAAGCCAACTCCAGAGAGGCCTTGCCCATGCTGGCTTCCGCCTGCCCAGGC
TGGATCTGCTATGCTGAGAAGACTCATGGCAACTTCATTCTCCCCTACATCAGTACAGCCCGAT
CCCCACAGCAGGTTATGGGCTCCCTGATCAAAGACTTCTTTGCACAGCAACAGCTCCTGACTCC
TGACAAGATCTACCACGTAACTGTGATGCCCTGCTATGACAAAAAACTAGAAGCATCCAGACCT
GACTTCTTCAACCAGGAGTACCAGACCCGTGACGTGGACTGTGTCCTTACAACAGGAGAAGTCT
TCAGACTGCTGGAGGAAGAAGGAGTCTCCCTCTCAGAGCTGGAGCCTGTGCCCCTGGATGGCTT
AACCAGGAGTGTGTCTGCTGAGGAGCCCACCAGCCATCGGGGCGGAGGCTCAGGAGGGTACCTG
GAGCACGTGTTCCGGCACGCAGCCCAAGAGCTGTTTGGAATCCATGTGGCTGACGTCACCTACC
AACCCATGAGGAACAAGGACTTCCAGGAAGTGACACTGGAGAGGGAAGGCCAGGTGCTGTTGCG
CTTTGCTGTGGCCTATGGCTTCCGCAACATCCAGAACCTCGTGCAGAAGTTAAAACGAGGCCGC
TGTCCCTACCATTACGTGGAAGTAATGGCCTGCCCTTCAGGCTGCTTGAATGGAGGGGGTCAGC
TCAAGGCTCCAGATACGGAAGGCAGGGAGCTCCTCCAGCAAGTGGAAAGACTGTACAGCATGGT
GAGGACCGAGGCGCCCGAAGATGCCCCTGGGGTCCAGGAGCTGTACCAGCATTGGCTGCAAGGC
GAGGACTCAGAGCGGGCCAGCCACCTGCTGCACACGCAGTACCATGCTGTGGAGAAGATCAACT
CAGGCCTCAGCATCAGGTGGTAGGAGGCCCTGAGTCTGTGAGAGCCCTGGGGGCAGCACCAAGG
CTCCCAGGAAGACTGTGTGGGTATCCGCCACAAGGCCCACGCAGAACATGCCAGAGGTCCTCAG
TTCAAGGAGAGCTCCATGGACGGTTGGATTCTTTGCTCCAGTGGGGCACTAGCTGCACATGGGT
CCTTGACCATACATGATCTGTGTCTCTGGCTGGTAATGTTGCCTGCAGCCCACACACCTCCAGG
GTCCACACTGAGATATGCAAGGTGAAGTGCAGGCAGGATCAGAGATACCCAAGTAGGTTCAATG
AGACTCCAGACTCTTCCTCTGGCCTGCCTTCCGGCTGTAGGTGTCTGAGTATAAGGGGTTTCAT
TTCTGTGGCTCACCCCCAAAACTACAACGTGTAGGGCAGATATCAAGCCTGAACCTAGTGGGGC
ACACAATCTTCTACAAACTGCCTGTTTGCTAGGGTCTTGGGCTCTGGCAGTCTGTCAGCTCCCA
GCCTCTATGGCTTTGAGAACGTCAGAGCTGGGTCTCACCACTAATAAACAGGTCTGCACCTCTG
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039086275 ⟹ XP_038942203

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	15,300,985 - 15,309,467 (+)	NCBI
mRatBN7.2	10	14,796,518 - 14,804,953 (+)	NCBI

RefSeq Acc Id:

XM_039086276 ⟹ XP_038942204

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	15,300,488 - 15,309,467 (+)	NCBI
mRatBN7.2	10	14,795,945 - 14,804,953 (+)	NCBI

RefSeq Acc Id:

XM_039086277 ⟹ XP_038942205

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	15,300,403 - 15,308,496 (+)	NCBI
mRatBN7.2	10	14,795,888 - 14,803,977 (+)	NCBI

RefSeq Acc Id:

XM_039086278 ⟹ XP_038942206

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	15,301,695 - 15,309,467 (+)	NCBI
mRatBN7.2	10	14,795,971 - 14,804,953 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001013201	(Get FASTA)	NCBI Sequence Viewer
	XP_038942203	(Get FASTA)	NCBI Sequence Viewer
	XP_038942204	(Get FASTA)	NCBI Sequence Viewer
	XP_038942205	(Get FASTA)	NCBI Sequence Viewer
	XP_038942206	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH91240	(Get FASTA)	NCBI Sequence Viewer
	EDM03951	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000026518
	ENSRNOP00000108952
GenBank Protein	Q5BK18	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001013201 ⟸ NM_001013183

- UniProtKB:

Q5BK18 (UniProtKB/Swiss-Prot), A6HD46 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASPFSGALQLTDLDDFIGPSQSCIKPVTVAKKPGSGIAKIHIEDDGSYFQVNPDGRSQKLEKA
KVSLNDCLACSGCVTSAETILITQQSHEELRKVLDANKVAAPGQQRLVVVSVSPQSRASLAARF
QLDSTDTARKLTSFFKKIGVHFVFDTAFARNFSLLESQKEFVQRFREQANSREALPMLASACPG
WICYAEKTHGNFILPYISTARSPQQVMGSLIKDFFAQQQLLTPDKIYHVTVMPCYDKKLEASRP
DFFNQEYQTRDVDCVLTTGEVFRLLEEEGVSLSELEPVPLDGLTRSVSAEEPTSHRGGGSGGYL
EHVFRHAAQELFGIHVADVTYQPMRNKDFQEVTLEREGQVLLRFAVAYGFRNIQNLVQKLKRGR
CPYHYVEVMACPSGCLNGGGQLKAPDTEGRELLQQVERLYSMVRTEAPEDAPGVQELYQHWLQG
EDSERASHLLHTQYHAVEKINSGLSIRW

hide sequence

Ensembl Acc Id:

ENSRNOP00000026518 ⟸ ENSRNOT00000026518

RefSeq Acc Id:	XP_038942205 ⟸ XM_039086277
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_038942204 ⟸ XM_039086276
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038942206 ⟸ XM_039086278
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_038942203 ⟸ XM_039086275
- Peptide Label:	isoform X1
- UniProtKB:	A0A8L2QFN5 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000108952 ⟸ ENSRNOT00000144894

Protein Domains

Iron hydrogenase small subunit

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5BK18-F1-model_v2	AlphaFold	Q5BK18	1-476	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697056

Promoter ID:

EPDNEW_R7581

Type:

multiple initiation site

Name:

Narfl_1

Description:

nuclear prelamin A recognition factor-like

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	15,143,717 - 15,143,777	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305982	AgrOrtholog
BioCyc Gene	G2FUF-25762	BioCyc
Ensembl Genes	ENSRNOG00000019522	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000026518	ENTREZGENE
	ENSRNOT00000144894	ENTREZGENE
Gene3D-CATH	3.40.50.1780	UniProtKB/Swiss-Prot
	Fe-only Hydrogenase (Larger Subunit), Chain L, domain 3	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7325087	IMAGE-MGC_LOAD
InterPro	Cytosolic_Fe-S_CAF	UniProtKB/Swiss-Prot
	Fe_hydrogenase	UniProtKB/Swiss-Prot
	Fe_hydrogenase_lsu_C	UniProtKB/Swiss-Prot
	Fe_hydrogenase_ssu	UniProtKB/Swiss-Prot
KEGG Report	rno:360496	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:109005	IMAGE-MGC_LOAD
NCBI Gene	360496	ENTREZGENE
PANTHER	NITRATE, FORMATE, IRON DEHYDROGENASE	UniProtKB/Swiss-Prot
Pfam	Fe_hyd_lg_C	UniProtKB/Swiss-Prot
	Fe_hyd_SSU	UniProtKB/Swiss-Prot
PhenoGen	Ciao3	PhenoGen
RatGTEx	ENSRNOG00000019522	RatGTEx
SMART	Fe_hyd_SSU	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF53920	UniProtKB/Swiss-Prot
UniProt	A0A8L2QFN5	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LDY9_RAT	UniProtKB/TrEMBL
	A6HD46	ENTREZGENE, UniProtKB/TrEMBL
	CIAO3_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-05-25	Ciao3	cytosolic iron-sulfur assembly component 3	Narfl	nuclear prelamin A recognition factor-like	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Narfl	nuclear prelamin A recognition factor-like	Narfl_predicted	nuclear prelamin A recognition factor-like (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Narfl_predicted	nuclear prelamin A recognition factor-like (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations