Advanced Search (OLGA)

Gene: Pop4 (POP4 ribonuclease P/MRP subunit) Rattus norvegicus

Analyze

Symbol:

Pop4

Name:

POP4 ribonuclease P/MRP subunit (Ensembl:POP4 homolog, ribonuclease P/MRP subunit)

RGD ID:

1305955

Description:

Predicted to enable ribonuclease P RNA binding activity. Predicted to contribute to ribonuclease P activity. Predicted to be involved in rRNA processing and tRNA 5'-leader removal. Predicted to be located in nucleolus. Predicted to be part of multimeric ribonuclease P complex and ribonuclease MRP complex. Orthologous to human POP4 (POP4 homolog, ribonuclease P/MRP subunit); PARTICIPATES IN tRNA maturation pathway; ribosome biogenesis pathway; RNA transport pathway; INTERACTS WITH 2,4-dinitrotoluene; 2,6-dinitrotoluene; acrylamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC292831; MGC108830; POP4 (processing of precursor , S. cerevisiae) homolog; POP4 homolog, ribonuclease P/MRP subunit; processing of precursor 4, ribonuclease P/MRP family, (S. cerevisiae); processing of precursor 4, ribonuclease P/MRP subunit; processing of precursor 4, ribonuclease P/MRP subunit (S. cerevisiae); ribonuclease P protein subunit p29

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	POP4 (POP4 ribonuclease P/MRP subunit)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Pop4 (processing of precursor 4, ribonuclease P/MRP family, (S. cerevisiae))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pop4 (POP4 ribonuclease P/MRP subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	POP4 (POP4 ribonuclease P/MRP subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	POP4 (POP4 homolog, ribonuclease P/MRP subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pop4 (POP4 ribonuclease P/MRP subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	POP4 (POP4 homolog, ribonuclease P/MRP subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	POP4 (POP4 ribonuclease P/MRP subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pop4 (POP4 ribonuclease P/MRP subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Pop4 (POP4 ribonuclease P/MRP subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	MED31 (mediator complex subunit 31)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	POP4 (POP4 ribonuclease P/MRP subunit)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pop4 (processing of precursor 4, ribonuclease P/MRP family, (S. cerevisiae))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pop4 (POP4 homolog, ribonuclease P/MRP subunit)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C15C6.4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	C15C6.4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG8038	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	POP4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	POP4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	pop4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pop4	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	100,096,722 - 100,105,056 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	100,096,723 - 100,105,104 (-)	Ensembl				GRCr8
mRatBN7.2	1	90,960,026 - 90,968,360 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	90,960,022 - 90,968,443 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	96,355,706 - 96,364,040 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	104,821,432 - 104,829,766 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	98,114,012 - 98,122,346 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	94,661,127 - 94,669,461 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	94,661,128 - 94,669,461 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	95,761,042 - 95,769,376 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	90,749,092 - 90,757,426 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	85,290,486 - 85,298,820 (-)	NCBI		Celera
RGSC_v3.1	1	90,827,203 - 90,835,537 (-)	NCBI
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Ovarian Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

4,4'-sulfonyldiphenol (ISO)

acrylamide (EXP)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Butylbenzyl phthalate (ISO)

carbon nanotube (ISO)

chlordecone (ISO)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

Dibutyl phosphate (ISO)

diquat (ISO)

disodium selenite (ISO)

disulfiram (ISO)

flutamide (EXP)

GSK-J4 (ISO)

indole-3-methanol (EXP)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

oxaliplatin (EXP)

paracetamol (EXP)

perfluorooctane-1-sulfonic acid (ISO)

rac-lactic acid (ISO)

sodium arsenite (ISO)

T-2 toxin (ISO)

tamoxifen (ISO)

topotecan (EXP)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

RNA processing (IEA)

rRNA processing (IBA)

tRNA 5'-leader removal (IEA,ISO,ISS)

tRNA processing (IEA)

Cellular Component

multimeric ribonuclease P complex (ISO,ISS)

nucleolus (IEA,ISO)

ribonuclease MRP complex (IBA,IEA)

ribonuclease P complex (IBA,IEA)

Molecular Function

protein binding (ISO)

ribonuclease P activity (ISO,ISS)

ribonuclease P RNA binding (IBA,IEA,ISO,ISS)

RNA binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

ribosome biogenesis pathway (IEA)

RNA transport pathway (IEA)

tRNA maturation pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Unexpected diversity of RNase P, an ancient tRNA processing enzyme: challenges and prospects.	Lai LB, etal., FEBS Lett. 2010 Jan 21;584(2):287-96. doi: 10.1016/j.febslet.2009.11.048. Epub .
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:10444065	PMID:12477932	PMID:15489334	PMID:16723659	PMID:30454648

Genomics

Comparative Map Data

Pop4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	100,096,722 - 100,105,056 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	100,096,723 - 100,105,104 (-)	Ensembl				GRCr8
mRatBN7.2	1	90,960,026 - 90,968,360 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	90,960,022 - 90,968,443 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	96,355,706 - 96,364,040 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	104,821,432 - 104,829,766 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	98,114,012 - 98,122,346 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	94,661,127 - 94,669,461 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	94,661,128 - 94,669,461 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	95,761,042 - 95,769,376 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	90,749,092 - 90,757,426 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	85,290,486 - 85,298,820 (-)	NCBI		Celera
RGSC_v3.1	1	90,827,203 - 90,835,537 (-)	NCBI
Cytogenetic Map	1	q21	NCBI

POP4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	29,606,283 - 29,617,237 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	29,606,283 - 29,617,237 (+)	Ensembl			hg38	GRCh38
GRCh37	19	30,097,190 - 30,108,144 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	34,789,041 - 34,798,547 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	34,789,040 - 34,798,546	NCBI
Celera	19	26,794,995 - 26,805,986 (+)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI
HuRef	19	26,609,015 - 26,620,008 (+)	NCBI		HuRef
CHM1_1	19	30,098,506 - 30,109,497 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	32,131,858 - 32,142,812 (+)	NCBI		T2T-CHM13v2.0

Pop4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	37,962,239 - 37,970,803 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	37,961,420 - 37,970,847 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	38,262,812 - 38,271,393 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	38,261,996 - 38,271,423 (-)	Ensembl			mm10	GRCm38
MGSCv37	7	39,047,839 - 39,056,367 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	37,971,908 - 37,980,436 (-)	NCBI		MGSCv36	mm8
Celera	7	33,428,334 - 33,436,939 (-)	NCBI		Celera
Cytogenetic Map	7	B3	NCBI
cM Map	7	25.36	NCBI

Pop4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955468	7,983,394 - 7,994,453 (-)	Ensembl
ChiLan1.0	NW_004955468	7,983,394 - 7,994,863 (-)	NCBI	ChiLan1.0	ChiLan1.0

POP4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	35,585,460 - 35,598,651 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	37,584,187 - 37,593,992 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	26,535,196 - 26,544,747 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	35,296,084 - 35,307,008 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	35,296,084 - 35,307,002 (+)	Ensembl			panPan2	panpan1.1

POP4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	121,809,448 - 121,815,811 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	121,809,701 - 121,815,443 (-)	Ensembl			canFam3	CanFam3.1
ROS_Cfam_1.0	1	122,438,312 - 122,445,920 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	122,438,570 - 122,469,729 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	122,017,863 - 122,025,413 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	121,625,445 - 121,632,908 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	122,689,508 - 122,697,011 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Pop4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	5,931,203 - 5,948,471 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936570	5,702,478 - 5,714,892 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936570	5,704,692 - 5,714,666 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

POP4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	39,734,559 - 39,760,953 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	39,734,523 - 39,745,972 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	35,027,615 - 35,039,073 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

POP4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	24,673,364 - 24,683,017 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	24,675,868 - 24,682,683 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666073	2,202,042 - 2,211,582 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pop4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624794	4,791,609 - 4,801,359 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624794	4,788,960 - 4,799,307 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Pop4
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	160,367,927 - 160,376,120 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Pop4
27 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	172
Count of miRNA genes:	134
Interacting mature miRNAs:	140
Transcripts:	ENSRNOT00000020474
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	51940904	101229020	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	87889942	132889942	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	39728272	132889942	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
2300324	Fetw1	Fetal weight QTL 1	12.1	0.005	fetal growth trait (VT:0004201)	fetal body weight (CMO:0002080)	1	92963855	109494029	Rat
1331800	Scl25	Serum cholesterol level QTL 25	3.013		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	87785026	142582336	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	83019780	128019780	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	66404680	111404680	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	93903998	191260518	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	66400974	132889942	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	84107164	115183752	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	91302413	136302413	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	99645382	182701046	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	99645382	221502378	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	86622262	131622262	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	58769992	103769992	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	66077886	111077886	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	98879955	208479939	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of, or within a discrete space in an open field apparatus (CMO:0001514)	1	92683681	137683681	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	52891222	109116986	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	86993904	131993904	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	87558587	132558587	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	92683681	137683681	Rat
737977	Bp160	Blood pressure QTL 160		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	97582336	142582336	Rat
724529	Cm16	Cardiac mass QTL 16	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	1	96717367	160111531	Rat

Markers in Region

RH127886

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	90,960,225 - 90,960,424 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	94,661,327 - 94,661,525	NCBI	Rnor6.0
Rnor_5.0	1	95,761,242 - 95,761,440	UniSTS	Rnor5.0
RGSC_v3.4	1	90,749,292 - 90,749,490	UniSTS	RGSC3.4
Celera	1	85,290,686 - 85,290,884	UniSTS
Cytogenetic Map	1	q22	UniSTS

RH129653

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	90,960,067 - 90,960,261 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	94,661,169 - 94,661,362	NCBI	Rnor6.0
Rnor_5.0	1	95,761,084 - 95,761,277	UniSTS	Rnor5.0
RGSC_v3.4	1	90,749,134 - 90,749,327	UniSTS	RGSC3.4
Celera	1	85,290,528 - 85,290,721	UniSTS
RH 3.4 Map	1	883.89	UniSTS
Cytogenetic Map	1	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001009642	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC120712	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088183	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214192	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000020474 ⟹ ENSRNOP00000020474

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	100,096,723 - 100,105,104 (-)	Ensembl
mRatBN7.2 Ensembl	1	90,960,022 - 90,968,443 (-)	Ensembl
Rnor_6.0 Ensembl	1	94,661,128 - 94,669,461 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096810 ⟹ ENSRNOP00000082761

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	90,960,022 - 90,965,107 (-)	Ensembl

RefSeq Acc Id:

NM_001009642 ⟹ NP_001009642

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	100,096,722 - 100,105,056 (-)	NCBI
mRatBN7.2	1	90,960,026 - 90,968,360 (-)	NCBI
Rnor_6.0	1	94,661,127 - 94,669,461 (-)	NCBI
Rnor_5.0	1	95,761,042 - 95,769,376 (-)	NCBI
RGSC_v3.4	1	90,749,092 - 90,757,426 (-)	RGD
Celera	1	85,290,486 - 85,298,820 (-)	RGD

Sequence:

show sequence

GTTTCTTGGGCTTATCGGATTTTTTTCAGGTGGAAACTTAAACTTAAACAAAAAAGCATCCAAG
TGGGGGTAAAAACCTCTGAACAAAGCGAAGAAAGGAAAAGAATGCATGAGGCCTGGAGGAGACA
TCATTAGAGCGCTCCGGAAGCTGGCCGACAATGAAGGCTGTGATCTACCATGCCTTTTCTCATA
AAGAAGCCAAGGACCACGATGTGCAGGAGCTGGGAACCCAGCGGGCTGAGGCCTTTGTGCGGGC
CTTCCTGAAGCAGAGCATACCTCACATGAGCCAACAAGACTGCGAGAGCCATCTGCAACGCAAG
GCTGTGATCTTGGAATATTTCACTCGCCTGAAGCCGAAGCCAAGGCCAAAGAAGAAATCCAAAG
GCCTCTCTGCCAAACAGAGGAGAGAGCTGCGGCTCTTTGACATTAAACCAGAGCAACAGAGATA
CAGTCTCTTCCTCCCTCTACATGAACTCTGGAAACAGTACATCCGTGACCTGTGCAATGGGCTC
AAGCCAGACACGCAGCCACAGATGATTCAGGCCAAGCTCCTAAAGGCAGATCTTCATGGCGCTG
TTATTTCAGTCACGAAATCCAAGTGCCCCTCCTATGTGGGAGTTACGGGAATCCTTCTGCAGGA
GACCAAGCATGTCTTCAAGATCATCACCAAAGAAGACCACCTGAAAGTTATCCCTAAGCAAAAT
TGTGTGTTCACCATAGAAATTGATGACTTCATTTCCTACATTTATGGAAGCAAATTCCAGCTTC
GGGCAAGTGAGCGGTCTGCCAAGAAGTTCAAAGCAAAGGGAACAATTGACCTATGAACTCTTTG
CCACTGGAGACAGATGTCCCTGACACCTGAGAACTGGAAACACCCTGAGTGTTCACTTTTCCTT
GAAGAACCTCTGGCTGTAGCCCGCCTCTAGTCCAGGGAAAACAGGGGCTGAAGAATATTGAACA
ACGCAAGAGAAAGCTAGGGGTAGATATTTGTATTTTTAGCTAACTAAAGTTAGCTTTAGTTGTA
CAGGGAGGAAAGACTAGCAGAAATACACCAGGATTAACCTTAGTTCATCTGAAGAAAAGGGCGT
TTAGGTTCTGTCTTTCCTACTTCTCTCTGTGTATCCTGAACATTCTAGCTAAGTCAGTTATTCA
AGTAATAATAAAACCAGACCACAGGCAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001009642	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88183	(Get FASTA)	NCBI Sequence Viewer
	EDM07588	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000020474
	ENSRNOP00000020474.4
GenBank Protein	Q5M882	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001009642 ⟸ NM_001009642

- UniProtKB:

Q5M882 (UniProtKB/Swiss-Prot), A6JAE6 (UniProtKB/TrEMBL), A0A8I5ZUJ2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MKAVIYHAFSHKEAKDHDVQELGTQRAEAFVRAFLKQSIPHMSQQDCESHLQRKAVILEYFTRL
KPKPRPKKKSKGLSAKQRRELRLFDIKPEQQRYSLFLPLHELWKQYIRDLCNGLKPDTQPQMIQ
AKLLKADLHGAVISVTKSKCPSYVGVTGILLQETKHVFKIITKEDHLKVIPKQNCVFTIEIDDF
ISYIYGSKFQLRASERSAKKFKAKGTIDL

hide sequence

Ensembl Acc Id:

ENSRNOP00000020474 ⟸ ENSRNOT00000020474

Ensembl Acc Id:

ENSRNOP00000082761 ⟸ ENSRNOT00000096810

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5M882-F1-model_v2	AlphaFold	Q5M882	1-221	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689978

Promoter ID:

EPDNEW_R503

Type:

multiple initiation site

Name:

Pop4_1

Description:

POP4 homolog, ribonuclease P/MRP subunit

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	94,669,521 - 94,669,581	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305955	AgrOrtholog
BioCyc Gene	G2FUF-59930	BioCyc
Ensembl Genes	ENSRNOG00000027646	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000020474	ENTREZGENE
	ENSRNOT00000020474.6	UniProtKB/Swiss-Prot
Gene3D-CATH	2.30.30.210	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7365498	IMAGE-MGC_LOAD
InterPro	RNase_P/MRP_p29	UniProtKB/Swiss-Prot
	RNase_P/MRP_p29-subunit	UniProtKB/Swiss-Prot
	RNase_P/MRP_p29_sf	UniProtKB/Swiss-Prot
	Rof/RNase_P-like	UniProtKB/Swiss-Prot
KEGG Report	rno:292831	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:108830	IMAGE-MGC_LOAD
NCBI Gene	292831	ENTREZGENE
PANTHER	PTHR13348	UniProtKB/Swiss-Prot
	RIBONUCLEASE P PROTEIN SUBUNIT P29	UniProtKB/Swiss-Prot
Pfam	UPF0086	UniProtKB/Swiss-Prot
PhenoGen	Pop4	PhenoGen
PIRSF	RNase_P/MRP_p29_subunit	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000027646	RatGTEx
SMART	POP4	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF101744	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZUJ2	ENTREZGENE
	A6JAE6	ENTREZGENE, UniProtKB/TrEMBL
	Q5M882	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2025-11-13	Pop4	POP4 ribonuclease P/MRP subunit	Pop4	POP4 homolog, ribonuclease P/MRP subunit	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-07-20	Pop4	POP4 homolog, ribonuclease P/MRP subunit	Pop4	processing of precursor 4, ribonuclease P/MRP subunit	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-07-17	Pop4	processing of precursor 4, ribonuclease P/MRP subunit	Pop4	processing of precursor 4, ribonuclease P/MRP subunit (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-24	Pop4	processing of precursor 4, ribonuclease P/MRP subunit (S. cerevisiae)	Pop4	processing of precursor 4, ribonuclease P/MRP family, (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Pop4	processing of precursor 4, ribonuclease P/MRP family, (S. cerevisiae)	Pop4_predicted	processing of precursor 4, ribonuclease P/MRP family, (S. cerevisiae) (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Pop4_predicted	processing of precursor 4, ribonuclease P/MRP family, (S. cerevisiae) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)