Advanced Search (OLGA)

Gene: Irak1bp1 (interleukin-1 receptor-associated kinase 1 binding protein 1) Rattus norvegicus

Analyze

Symbol:

Irak1bp1

Name:

interleukin-1 receptor-associated kinase 1 binding protein 1

RGD ID:

1305012

Description:

Predicted to enable signaling adaptor activity. Predicted to be involved in positive regulation of canonical NF-kappaB signal transduction. Predicted to be located in cytoplasm and nucleus. Orthologous to human IRAK1BP1 (interleukin 1 receptor associated kinase 1 binding protein 1); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

interleukin-1 receptor-associated kinase 1-binding protein 1; LOC300862

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	92,608,468 - 92,628,377 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	92,611,843 - 92,628,377 (+)	Ensembl				GRCr8
mRatBN7.2	8	83,731,512 - 83,748,289 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	83,731,507 - 83,748,289 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	89,332,889 - 89,349,394 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	87,562,551 - 87,578,912 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	85,425,138 - 85,441,643 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	90,343,307 - 90,360,085 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	90,343,154 - 90,360,086 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	89,871,572 - 89,888,350 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	87,956,612 - 87,972,991 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	83,395,203 - 83,411,558 (+)	NCBI		Celera
RGSC_v3.1	8	87,971,361 - 87,992,732 (+)	NCBI
Cytogenetic Map	8	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

DEVELOPMENTAL DELAY, INTELLECTUAL DISABILITY, OBESITY, AND DYSMORPHIC FEATURES (ISO)

Sjogren's syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

(1->4)-beta-D-glucan (ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4,4'-diaminodiphenylmethane (ISO)

acrylamide (ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

azathioprine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

C60 fullerene (EXP)

cadmium dichloride (EXP)

CGP 52608 (ISO)

chlorpyrifos (EXP)

chromium(6+) (ISO)

copper atom (EXP)

copper(0) (EXP)

crocidolite asbestos (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

ethanol (ISO)

furan (EXP)

gentamycin (EXP)

graphene oxide (ISO)

lead(0) (ISO)

methoxychlor (EXP)

methyl methanesulfonate (ISO)

N(4)-hydroxycytidine (ISO)

o-anisidine (ISO)

okadaic acid (ISO)

ozone (ISO)

paracetamol (EXP)

pentane-2,3-dione (EXP)

perfluorooctane-1-sulfonic acid (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

quercetin (ISO)

quinolin-8-ol (ISO)

resorcinol (ISO)

rotenone (EXP)

SB 431542 (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

Soman (EXP)

sunitinib (ISO)

testosterone (EXP)

thiram (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triphenyl phosphate (EXP,ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

DNA-templated transcription (IEA)

immune response (IEA)

positive regulation of canonical NF-kappaB signal transduction (IEA,ISO)

Cellular Component

cytoplasm (IEA)

nucleus (IEA)

Molecular Function

protein binding (ISO)

signaling adaptor activity (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:11096118	PMID:12477932

Genomics

Comparative Map Data

Irak1bp1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	92,608,468 - 92,628,377 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	92,611,843 - 92,628,377 (+)	Ensembl				GRCr8
mRatBN7.2	8	83,731,512 - 83,748,289 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	83,731,507 - 83,748,289 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	89,332,889 - 89,349,394 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	87,562,551 - 87,578,912 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	85,425,138 - 85,441,643 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	90,343,307 - 90,360,085 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	90,343,154 - 90,360,086 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	89,871,572 - 89,888,350 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	87,956,612 - 87,972,991 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	83,395,203 - 83,411,558 (+)	NCBI		Celera
RGSC_v3.1	8	87,971,361 - 87,992,732 (+)	NCBI
Cytogenetic Map	8	q31	NCBI

IRAK1BP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	78,867,551 - 78,979,411 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	78,867,551 - 78,946,440 (+)	Ensembl			hg38	GRCh38
GRCh37	6	79,577,268 - 79,612,819 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	79,633,908 - 79,665,039 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	6	79,964,472 - 79,995,608 (+)	NCBI		Celera
Cytogenetic Map	6	q14.1	NCBI
HuRef	6	76,770,948 - 76,801,978 (+)	NCBI		HuRef
CHM1_1	6	79,674,860 - 79,705,713 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	80,045,247 - 80,113,339 (+)	NCBI		T2T-CHM13v2.0

Irak1bp1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	82,711,859 - 82,729,741 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	82,711,593 - 82,729,740 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	9	82,829,806 - 82,847,688 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	82,829,540 - 82,847,687 (+)	Ensembl			mm10	GRCm38
MGSCv37	9	82,723,413 - 82,741,295 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	9	82,626,717 - 82,644,404 (+)	NCBI		MGSCv36	mm8
Celera	9	79,923,749 - 79,941,609 (+)	NCBI		Celera
Cytogenetic Map	9	E2	NCBI
cM Map	9	45.16	NCBI

Irak1bp1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955502	6,800,595 - 6,810,880 (+)	Ensembl
ChiLan1.0	NW_004955502	6,800,532 - 6,811,214 (+)	NCBI	ChiLan1.0	ChiLan1.0

IRAK1BP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	98,919,286 - 98,964,044 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	96,800,034 - 96,844,842 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	76,717,234 - 76,751,725 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	79,989,745 - 80,024,149 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	79,989,745 - 80,059,221 (+)	Ensembl			panPan2	panpan1.1

IRAK1BP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	39,857,331 - 39,883,471 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	39,857,392 - 39,875,399 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	39,730,626 - 39,756,820 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	40,629,322 - 40,655,543 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	40,629,475 - 40,652,623 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	39,950,728 - 39,976,830 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	39,929,288 - 39,955,433 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	40,060,083 - 40,086,305 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Irak1bp1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	75,228,265 - 75,252,846 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936510	11,217,024 - 11,242,667 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936510	11,220,194 - 11,242,485 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

IRAK1BP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	87,290,826 - 87,329,716 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	1	87,289,964 - 87,329,926 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	98,057,045 - 98,090,791 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

IRAK1BP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	3,575,414 - 3,615,533 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	3,575,497 - 3,616,019 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666040	179,805,411 - 179,841,308 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Irak1bp1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624819	5,570,647 - 5,584,705 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624819	5,570,897 - 5,584,964 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Irak1bp1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	8	77,004,613 - 77,023,263 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Irak1bp1
192 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	102
Count of miRNA genes:	88
Interacting mature miRNAs:	93
Transcripts:	ENSRNOT00000068482
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	63141536	109261840	Rat
1549909	Stresp11	Stress response QTL 11	6.83	0.0019	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	8	82352698	127352698	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	62848139	107848139	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	58337123	103337123	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	62848139	107848139	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	49849908	118871671	Rat
9590292	Uminl3	Urine mineral level QTL 3	3.62	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	8	80768445	125768445	Rat
1331804	Cm30	Cardiac mass QTL 30	3.77443		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	8	62970527	107970527	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	39106363	103375781	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	50763951	95763951	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	62848139	107848139	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	62848139	107848139	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	62848139	107848139	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	62848139	107848139	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	51589699	99045312	Rat
71120	Niddm21	Non-insulin dependent diabetes mellitus QTL 21	3.73		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	8	66992095	111992095	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	60248093	105248093	Rat
634332	Pia18	Pristane induced arthritis QTL 18	4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	84192326	132782436	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	39106363	103375781	Rat
1300171	Bp184	Blood pressure QTL 184	3.66		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	8	79394435	132782436	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	39106258	103375958	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	61019838	121662124	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	62848139	107848139	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	63404444	108404444	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	35464071	107982864	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	55428416	107963099	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	62963099	107963099	Rat
8694446	Bw170	Body weight QTL 170	12.07	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	8	80768445	125768445	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	70041301	121080908	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	50763951	107970527	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	68690349	119799881	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	49610204	94610204	Rat
10450865	Bw175	Body weight QTL 175	4.1		total fat pad mass (VT:0015008)	adipose tissue molecular composition measurement (CMO:0000484)	8	84192326	129192326	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	35464071	107982864	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	55428333	127966348	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	39106363	114525825	Rat
1582254	Kidm31	Kidney mass QTL 31	3		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	8	49245178	94245178	Rat
2300181	Bmd55	Bone mineral density QTL 55	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	85348065	130348065	Rat
724540	Uae8	Urinary albumin excretion QTL 8	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	8	39106258	103375958	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	62848139	107848139	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	35464071	107982864	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	62982864	107982864	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	62848139	107848139	Rat
1582243	Bw66	Body weight QTL 66	3.4	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	8	49245178	94245178	Rat
8694200	Abfw4	Abdominal fat weight QTL 4	9.07	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	8	80768445	125768445	Rat
8694392	Bw161	Body weight QTL 161	8.06	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	8	80768445	125768445	Rat
61437	Cia6	Collagen induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	91340911	131690273	Rat

Markers in Region

BF386647

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	83,730,951 - 83,731,114 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	90,342,501 - 90,342,663	NCBI	Rnor6.0
Rnor_5.0	8	89,870,766 - 89,870,928	UniSTS	Rnor5.0
RGSC_v3.4	8	87,955,943 - 87,956,105	UniSTS	RGSC3.4
Celera	8	83,394,397 - 83,394,559	UniSTS
RH 3.4 Map	8	966.19	UniSTS
Cytogenetic Map	8	q31	UniSTS

BE120084

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	83,746,933 - 83,747,148 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	90,358,730 - 90,358,944	NCBI	Rnor6.0
Rnor_5.0	8	89,886,995 - 89,887,209	UniSTS	Rnor5.0
RGSC_v3.4	8	87,971,923 - 87,972,137	UniSTS	RGSC3.4
Celera	8	83,410,203 - 83,410,417	UniSTS
RH 3.4 Map	8	964.5	UniSTS
Cytogenetic Map	8	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	77	59	6	341	177	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001277283	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063265187	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010053950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC159433	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215646	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229432	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000068482 ⟹ ENSRNOP00000062372

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	83,731,507 - 83,748,231 (+)	Ensembl
Rnor_6.0 Ensembl	8	90,343,154 - 90,360,086 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000109983 ⟹ ENSRNOP00000093555

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	92,611,890 - 92,628,377 (+)	Ensembl
mRatBN7.2 Ensembl	8	83,731,801 - 83,748,289 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116444 ⟹ ENSRNOP00000079440

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	92,611,843 - 92,628,375 (+)	Ensembl
mRatBN7.2 Ensembl	8	83,731,747 - 83,748,289 (+)	Ensembl

RefSeq Acc Id:

NM_001277283 ⟹ NP_001264212

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	92,611,847 - 92,628,377 (+)	NCBI
mRatBN7.2	8	83,731,758 - 83,748,289 (+)	NCBI
Rnor_6.0	8	90,343,307 - 90,360,085 (+)	NCBI
Rnor_5.0	8	89,871,572 - 89,888,350 (+)	NCBI
Celera	8	83,395,203 - 83,411,558 (+)	NCBI

Sequence:

show sequence

GCCGTCGACCCGGAGTTGCTATGGCAACGCAGTTGCCCCAGCTATGTCGCTGCAACCCGCCCCT
GCATCGCGGGTGTTCATGGAACTGGTTCCCTGGGCTGACCCGGGCCGGGAAAACCACCAGATCT
CGGCCGTAGAAGCGCAGCCCGTCGGCTTCCGCCCCCACAATGCGCAGGTCCACCCCGGAGCCCG
GGAGGTCCACGTGAGCGGCGCGGCGGAGGTGTCCGCCAGCCCAGACCGGGCGCTGGTGACCGTG
CGGGTGAGCAGCACCAAGGAGGTGGCGGCAGAGGCCAAGAAGAGTGTGTGTCGCCGCCTGGACT
ACATCACACAGAGCCTCCAGCAGCAAGGTGTGCAGACAGAGAATGTAACTGTGACAAAGGATTT
CAGAAGAGTAGACAATGCTTACCACATGGAAGCCGAGGTCTGCATTACATTTACTGAATTTGGA
AAAATGCAAAATATTTGTAACTTTCTGGTTGAAAAGCTGGATAGCTCTGTTGTCATCAGCCCAC
CTGAGTTCTATCACACACCCGGTTCCGTTGAGAGTCTTCGGCGGCAGGCCTGTCTCGCTGCTGT
TGAGAATGCATGGCGAAAAGCTCAAGAAGTCTGTGCCCTCGTTGGCCAAACTCTGGAAAGACCT
TTACTAATCAAGGAGGAGGAAACAAAAGACTGGGAAGGCCAAGCGGATGATCATCAGTTGTCCA
GCTTGCCAGGTTTTTTAACTATACAACAGAAAATCAAAAGTGCAACCATCCATGCAGCTTCAAA
AGTGTTCATTACTTACGAGGTGAAAGGAAAAGAGAGGAAAAAAAAGCATCTGTAAAATTCTAAC
TGAAACATAATGTATTTGTACTTATAAATCTGTTTTTATACATTTTACAGCACTGCTTTTTGTC
TCAAATGTAACTGTTGTCTGGTACTGGTAATCTGTAAGATCTGCCACTTGTTGAACATATCCCT
CAGAATATGTGTGATCTCTTTCTAGTTCCCAGAACACCGTCGGAAATAAATGTATTAAAGCATA
CTTTTGTATACTGAGAATTTATATATTGAAAATAAAATTAACAGAAAACCCAG

hide sequence

RefSeq Acc Id:

XM_063265187 ⟹ XP_063121257

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	92,608,468 - 92,628,376 (+)	NCBI

RefSeq Acc Id:

XR_010053950

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	92,608,468 - 92,627,777 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001264212	(Get FASTA)	NCBI Sequence Viewer
	XP_063121257	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI59434	(Get FASTA)	NCBI Sequence Viewer
	EDL77677	(Get FASTA)	NCBI Sequence Viewer
	EDL77678	(Get FASTA)	NCBI Sequence Viewer
	EDL77679	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000079440
	ENSRNOP00000079440.2
	ENSRNOP00000093555.1

RefSeq Acc Id:

NP_001264212 ⟸ NM_001277283

- UniProtKB:

D3ZBV8 (UniProtKB/TrEMBL), B0K033 (UniProtKB/TrEMBL), A6I1P8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSLQPAPASRVFMELVPWADPGRENHQISAVEAQPVGFRPHNAQVHPGAREVHVSGAAEVSASP
DRALVTVRVSSTKEVAAEAKKSVCRRLDYITQSLQQQGVQTENVTVTKDFRRVDNAYHMEAEVC
ITFTEFGKMQNICNFLVEKLDSSVVISPPEFYHTPGSVESLRRQACLAAVENAWRKAQEVCALV
GQTLERPLLIKEEETKDWEGQADDHQLSSLPGFLTIQQKIKSATIHAASKVFITYEVKGKERKK
KHL

hide sequence

Ensembl Acc Id:

ENSRNOP00000062372 ⟸ ENSRNOT00000068482

Ensembl Acc Id:

ENSRNOP00000093555 ⟸ ENSRNOT00000109983

Ensembl Acc Id:

ENSRNOP00000079440 ⟸ ENSRNOT00000116444

RefSeq Acc Id:	XP_063121257 ⟸ XM_063265187
- Peptide Label:	isoform X1
- UniProtKB:	A6I1P9 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZBV8-F1-model_v2	AlphaFold	D3ZBV8	1-259	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305012	AgrOrtholog
BioCyc Gene	G2FUF-29712	BioCyc
Ensembl Genes	ENSRNOG00000008984	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000109983.2	UniProtKB/TrEMBL
	ENSRNOT00000116444	ENTREZGENE
	ENSRNOT00000116444.2	UniProtKB/TrEMBL
Gene3D-CATH	Protein of unknown function (DUF541), domain 1	UniProtKB/TrEMBL
	Protein of unknown function (DUF541), domain 2	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:9093094	IMAGE-MGC_LOAD
InterPro	DUF541	UniProtKB/TrEMBL
	IRAK1BP1	UniProtKB/TrEMBL
KEGG Report	rno:300862	UniProtKB/TrEMBL
MGC_CLONE	MGC:188759	IMAGE-MGC_LOAD
NCBI Gene	300862	ENTREZGENE
PANTHER	INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 1-BINDING PROTEIN 1	UniProtKB/TrEMBL
	PTHR18842	UniProtKB/TrEMBL
Pfam	SIMPL	UniProtKB/TrEMBL
PhenoGen	Irak1bp1	PhenoGen
RatGTEx	ENSRNOG00000008984	RatGTEx
UniProt	A0A8I6AKL7_RAT	UniProtKB/TrEMBL
	A6I1P8	ENTREZGENE, UniProtKB/TrEMBL
	A6I1P9	ENTREZGENE, UniProtKB/TrEMBL
	B0K033	ENTREZGENE
	D3ZBV8	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	A0A8I5ZN39	UniProtKB/TrEMBL
	B0K033	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Irak1bp1	interleukin-1 receptor-associated kinase 1 binding protein 1	Irak1bp1_predicted	interleukin-1 receptor-associated kinase 1 binding protein 1 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Irak1bp1_predicted	interleukin-1 receptor-associated kinase 1 binding protein 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD