Advanced Search (OLGA)

Gene: Prr4 (proline rich 4) Rattus norvegicus

Analyze

Symbol:

Prr4

Name:

proline rich 4

RGD ID:

735181

Description:

Predicted to be involved in biomineral tissue development. Predicted to be located in extracellular region. Orthologous to human PRR4 (proline rich 4); INTERACTS WITH ammonium chloride; bisphenol A; tributylstannane.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

contiguous repeat polypeptide; CRP; glutamine/glutamic acid-rich protein A; glutamine/glutamic acid-rich protein B; GRP-CA; GRP-CB; Grpca; Grpcb; hypothetical gene supported by M31032, NM_181440; LOC360395; rCG29588-like; Submandibular gland secretory Glx-rich protein CA; submandibular gland secretory Glx-rich protein CB

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	168,336,501 - 168,340,300 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	168,275,146 - 168,338,983 (+)	Ensembl				GRCr8
mRatBN7.2	4	166,605,104 - 166,608,903 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	166,543,755 - 166,607,586 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	172,898,518 - 172,902,315 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	168,681,567 - 168,685,364 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	167,307,523 - 167,311,320 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	167,419,911 - 167,485,225 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	167,351,697 - 167,485,225 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	230,114,339 - 230,114,629 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	170,578,759 - 170,583,974 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	155,205,716 - 155,209,513 (+)	NCBI		Celera
RGSC_v3.1	4	170,757,736 - 170,828,910 (+)	NCBI
Cytogenetic Map	4	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

cisplatin (ISO)

cyclosporin A (ISO)

paracetamol (ISO)

S-nitrosoglutathione (ISO)

silicon dioxide (ISO)

thapsigargin (ISO)

tributylstannane (EXP)

tunicamycin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biomineral tissue development (IEA)

Cellular Component

extracellular region (IEA)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Genes encoding proteins with homologous contiguous repeat sequences are highly expressed in the serous cells of the rat submandibular gland.	Heinrich G and Habener JF, J Biol Chem 1987 Apr 15;262(11):5262-70.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:1995617	PMID:2438276	PMID:22664934	PMID:23580065

Genomics

Comparative Map Data

Prr4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	168,336,501 - 168,340,300 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	168,275,146 - 168,338,983 (+)	Ensembl				GRCr8
mRatBN7.2	4	166,605,104 - 166,608,903 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	166,543,755 - 166,607,586 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	172,898,518 - 172,902,315 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	168,681,567 - 168,685,364 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	167,307,523 - 167,311,320 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	167,419,911 - 167,485,225 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	167,351,697 - 167,485,225 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	230,114,339 - 230,114,629 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	170,578,759 - 170,583,974 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	155,205,716 - 155,209,513 (+)	NCBI		Celera
RGSC_v3.1	4	170,757,736 - 170,828,910 (+)	NCBI
Cytogenetic Map	4	q42	NCBI

PRR4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	10,845,849 - 10,849,475 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	10,845,849 - 11,171,600 (-)	Ensembl			hg38	GRCh38
GRCh37	12	10,998,448 - 11,002,074 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	10,889,715 - 11,215,480 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	12	10,889,748 - 10,893,319	NCBI
Celera	12	16,146,762 - 16,466,622 (-)	NCBI		Celera
Cytogenetic Map	12	p13.2	NCBI
HuRef	12	10,727,284 - 10,730,911 (-)	NCBI		HuRef
CHM1_1	12	10,967,811 - 10,971,438 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	10,718,942 - 10,722,568 (-)	NCBI		T2T-CHM13v2.0

5530400C23Rik
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	133,269,179 - 133,272,753 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	133,269,179 - 133,272,755 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	133,292,216 - 133,295,790 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	133,292,216 - 133,295,792 (+)	Ensembl			mm10	GRCm38
MGSCv37	6	133,242,234 - 133,245,808 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	133,257,909 - 133,261,485 (+)	NCBI		MGSCv36	mm8
Cytogenetic Map	6	G1	NCBI
cM Map	6	64.03	NCBI

LOC100980504
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	16,436,702 - 16,495,963 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	16,433,458 - 16,498,272 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	10,874,083 - 11,057,096 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	11,140,167 - 11,143,783 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	11,317,697 - 11,318,596 (-)	Ensembl			panPan2	panpan1.1
PanPan1.1 Ensembl	12	11,140,167 - 11,143,783 (-)	Ensembl			panPan2	panpan1.1

PRR4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	10,685,061 - 10,690,705 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666089	2,762,583 - 2,766,188 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Prr4
24 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	12
Count of miRNA genes:	12
Interacting mature miRNAs:	12
Transcripts:	ENSRNOT00000007659
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
6478754	Anxrr43	Anxiety related response QTL 43		0.14035	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	146370897	184426481	Rat
724558	Plsm2	Polydactyly-luxate syndrome (PLS) morphotypes QTL 2		0.0003	hindlimb integrity trait (VT:0010563)	hind foot phalanges count (CMO:0001949)	4	134095016	179095016	Rat
1582237	Kidm34	Kidney mass QTL 34	4	0.0001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	4	149763204	169799698	Rat
6478693	Anxrr32	Anxiety related response QTL 32		0.00092	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	146370897	184426481	Rat
6478757	Anxrr44	Anxiety related response QTL 44		0.01087	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
1358364	Sradr4	Stress Responsive Adrenal Weight QTL 4	4.92		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	131384565	176384565	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	27730518	170099664	Rat
61451	Ciaa4	CIA Autoantibody QTL 4	3.1		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	4	123870974	168870974	Rat
1331738	Bp209	Blood pressure QTL 209	2.979		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	140059299	181024663	Rat
6478700	Anxrr33	Anxiety related response QTL 33		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
1298524	Oia8	Oil induced arthritis QTL 8			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	140059299	184426481	Rat
10053718	Scort25	Serum corticosterone level QTL 25	2.15	0.0097	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	157292416	184426481	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	60916264	184426481	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	94638356	168870820	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	106848959	168870974	Rat
7411558	Bw133	Body weight QTL 133	13.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	127263297	172263297	Rat
6478778	Anxrr51	Anxiety related response QTL 51		0.25384	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	126334185	171334185	Rat
10401796	Kidm48	Kidney mass QTL 48			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	147299608	184426481	Rat
6478718	Anxrr34	Anxiety related response QTL 34		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
6478782	Anxrr52	Anxiety related response QTL 52		0.02091	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
631511	Pia7	Pristane induced arthritis QTL 7	4.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	123870974	168870974	Rat
634347	Hcar8	Hepatocarcinoma resistance QTL 8	5.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	124700988	169700988	Rat
6478720	Alc23	Alcohol consumption QTL 23		0.00509	drinking behavior trait (VT:0001422)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	155834926	184426481	Rat
6478785	Anxrr53	Anxiety related response QTL 53		0.01397	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	174095838	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	100752691	179366077	Rat
1581566	Eae21	Experimental allergic encephalomyelitis QTL 21	6.2		body mass (VT:0001259)	maximum body weight loss to initial body weight ratio (CMO:0001400)	4	137447185	182447185	Rat
1578674	Bmd12	Bone mineral density QTL 12	3.8		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	4	137430611	182430611	Rat
6478728	Anxrr36	Anxiety related response QTL 36		0.01061	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	184426481	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	86709649	168870974	Rat
61422	Cia13	Collagen induced arthritis QTL 13	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	134199006	168870974	Rat
634342	Cia24	Collagen induced arthritis QTL 24	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	148121375	176967367	Rat
6478733	Anxrr37	Anxiety related response QTL 37		0.00095	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
737978	Pia23	Pristane induced arthritis QTL 23	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	123870974	168870974	Rat
61362	Oia2	Oil induced arthritis QTL 2		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	140059299	184426481	Rat
6478737	Anxrr38	Anxiety related response QTL 38		0.00159	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
2293659	Bmd35	Bone mineral density QTL 35	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	4	160623982	184426481	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat
6478748	Anxrr42	Anxiety related response QTL 42		0.28008	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
12798525	Anxrr57	Anxiety related response QTL 57	3.21	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	148834094	168870974	Rat

Markers in Region

BI283313

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RH 3.4 Map	4	1014.7	UniSTS
Cytogenetic Map	4	q43	UniSTS

BI284106

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	166,607,357 - 166,607,568 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	167,483,682 - 167,483,892	NCBI	Rnor6.0
Rnor_5.0	4	230,011,013 - 230,011,223	UniSTS	Rnor5.0
RGSC_v3.4	4	170,581,700 - 170,581,910	UniSTS	RGSC3.4
RGSC_v3.4	4	170,581,700 - 170,582,641	UniSTS	RGSC3.4
Celera	4	155,207,970 - 155,208,180	UniSTS
RH 3.4 Map	4	1015.4	UniSTS
Cytogenetic Map	4	q43	UniSTS

BI279098

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	166,607,313 - 166,607,477 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	167,483,638 - 167,483,801	NCBI	Rnor6.0
Rnor_5.0	4	230,010,969 - 230,011,132	UniSTS	Rnor5.0
RGSC_v3.4	4	170,581,656 - 170,581,819	UniSTS	RGSC3.4
Celera	4	155,207,926 - 155,208,089	UniSTS
RH 3.4 Map	4	1014.7	UniSTS
Cytogenetic Map	4	q43	UniSTS

BI279219

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RH 3.4 Map	4	1014.7	UniSTS
Cytogenetic Map	4	q43	UniSTS

BI279351

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	166,607,317 - 166,607,477 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	167,483,642 - 167,483,801	NCBI	Rnor6.0
Rnor_5.0	4	230,010,973 - 230,011,132	UniSTS	Rnor5.0
RGSC_v3.4	4	170,581,660 - 170,581,819	UniSTS	RGSC3.4
Celera	4	155,207,930 - 155,208,089	UniSTS
RH 3.4 Map	4	1014.01	UniSTS
Cytogenetic Map	4	q43	UniSTS

BI279398

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RH 3.4 Map	4	1015.4	UniSTS
Cytogenetic Map	4	q43	UniSTS

BI279423

Rat Assembly	Chr	Position (strand)	Source
Celera	4	155,149,944 - 155,150,106	UniSTS
RH 3.4 Map	4	1014.7	UniSTS
Cytogenetic Map	4	q43	UniSTS

BI279495

Rat Assembly	Chr	Position (strand)	Source
Celera	4	155,149,913 - 155,150,105	UniSTS
RH 3.4 Map	4	1014.01	UniSTS
Cytogenetic Map	4	q43	UniSTS

BI279505

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	166,546,001 - 166,546,169 (+)	MAPPER	mRatBN7.2
mRatBN7.2	4	166,607,294 - 166,607,472 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	167,483,619 - 167,483,796	NCBI	Rnor6.0
Rnor_5.0	4	230,010,950 - 230,011,127	UniSTS	Rnor5.0
RH 3.4 Map	4	1014.7	UniSTS
Cytogenetic Map	4	q43	UniSTS

BI283265

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	166,546,117 - 166,546,275 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	167,422,030 - 167,422,187	NCBI	Rnor6.0
Rnor_5.0	4	229,949,361 - 229,949,518	UniSTS	Rnor5.0
RGSC_v3.4	4	170,516,423 - 170,516,580	UniSTS	RGSC3.4
RGSC_v3.4	4	170,515,714 - 170,515,871	UniSTS	RGSC3.4
Celera	4	155,149,948 - 155,150,105	UniSTS
RH 3.4 Map	4	1014.7	UniSTS
Cytogenetic Map	4	q43	UniSTS

BI283266

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	166,546,082 - 166,546,275 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	167,421,995 - 167,422,187	NCBI	Rnor6.0
Rnor_5.0	4	229,949,326 - 229,949,518	UniSTS	Rnor5.0
RGSC_v3.4	4	170,515,679 - 170,515,871	UniSTS	RGSC3.4
RGSC_v3.4	4	170,515,679 - 170,516,580	UniSTS	RGSC3.4
Celera	4	155,149,913 - 155,150,105	UniSTS
RH 3.4 Map	4	1014.7	UniSTS
Cytogenetic Map	4	q43	UniSTS

BI283275

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	166,607,315 - 166,607,477 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	167,483,640 - 167,483,801	NCBI	Rnor6.0
Rnor_5.0	4	230,010,971 - 230,011,132	UniSTS	Rnor5.0
RGSC_v3.4	4	170,581,658 - 170,581,819	UniSTS	RGSC3.4
Celera	4	155,207,928 - 155,208,089	UniSTS
RH 3.4 Map	4	1015.4	UniSTS
Cytogenetic Map	4	q43	UniSTS

BI283609

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	166,546,122 - 166,546,275 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	167,422,035 - 167,422,187	NCBI	Rnor6.0
Rnor_5.0	4	229,949,366 - 229,949,518	UniSTS	Rnor5.0
RGSC_v3.4	4	170,516,428 - 170,516,580	UniSTS	RGSC3.4
RGSC_v3.4	4	170,515,719 - 170,515,871	UniSTS	RGSC3.4
Celera	4	155,149,953 - 155,150,105	UniSTS
RH 3.4 Map	4	1014.9	UniSTS
Cytogenetic Map	4	q43	UniSTS

BI279233

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	166,607,310 - 166,607,477 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	167,483,635 - 167,483,801	NCBI	Rnor6.0
Rnor_5.0	4	230,010,966 - 230,011,132	UniSTS	Rnor5.0
RGSC_v3.4	4	170,581,653 - 170,581,819	UniSTS	RGSC3.4
Celera	4	155,207,923 - 155,208,089	UniSTS
RH 3.4 Map	4	1014.7	UniSTS
Cytogenetic Map	4	q43	UniSTS

BI279379

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RH 3.4 Map	4	1014.7	UniSTS
Cytogenetic Map	4	q43	UniSTS

BI279504

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	166,607,294 - 166,607,473 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	167,483,619 - 167,483,797	NCBI	Rnor6.0
Rnor_5.0	4	230,010,950 - 230,011,128	UniSTS	Rnor5.0
RH 3.4 Map	4	1014.1	UniSTS
Cytogenetic Map	4	q43	UniSTS

BI279543

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	4	229,949,120 - 229,949,347	UniSTS	Rnor5.0
Rnor_5.0	4	229,949,189 - 229,949,347	UniSTS	Rnor5.0
RH 3.4 Map	4	1014.7	UniSTS
Cytogenetic Map	4	q43	UniSTS

BI281298

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	166,546,064 - 166,546,275 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	167,421,977 - 167,422,187	NCBI	Rnor6.0
Rnor_5.0	4	229,949,308 - 229,949,518	UniSTS	Rnor5.0
RGSC_v3.4	4	170,515,661 - 170,515,871	UniSTS	RGSC3.4
RGSC_v3.4	4	170,515,661 - 170,516,580	UniSTS	RGSC3.4
Celera	4	155,149,895 - 155,150,105	UniSTS
RH 3.4 Map	4	1014.51	UniSTS
Cytogenetic Map	4	q43	UniSTS

BI282833

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	4	168,277,509 - 168,277,672 (+)	Marker Load Pipeline
mRatBN7.2	4	166,546,111 - 166,546,275 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	167,422,024 - 167,422,187	NCBI	Rnor6.0
Rnor_5.0	4	229,949,355 - 229,949,518	UniSTS	Rnor5.0
RGSC_v3.4	4	170,515,708 - 170,515,871	UniSTS	RGSC3.4
RGSC_v3.4	4	170,516,417 - 170,516,580	UniSTS	RGSC3.4
Celera	4	155,149,942 - 155,150,105	UniSTS
RH 3.4 Map	4	1014.7	UniSTS
Cytogenetic Map	4	q43	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
1	3	12	13	11	1	5	1	1	19	12	7	5	48	10	1	1

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_203332	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF152864	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M31032	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M58654	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000007659 ⟹ ENSRNOP00000007659

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	168,275,146 - 168,338,983 (+)	Ensembl
mRatBN7.2 Ensembl	4	166,543,755 - 166,547,612 (+)	Ensembl
Rnor_6.0 Ensembl	4	167,351,697 - 167,423,524 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000038396 ⟹ ENSRNOP00000035576

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	168,336,501 - 168,338,983 (+)	Ensembl
mRatBN7.2 Ensembl	4	166,544,647 - 166,546,296 (+)	Ensembl
Rnor_6.0 Ensembl	4	167,419,911 - 167,485,225 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000046622 ⟹ ENSRNOP00000040244

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	4	167,351,727 - 167,353,973 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000078821 ⟹ ENSRNOP00000073391

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	168,275,152 - 168,338,983 (+)	Ensembl
mRatBN7.2 Ensembl	4	166,543,755 - 166,607,586 (+)	Ensembl
Rnor_6.0 Ensembl	4	167,419,911 - 167,485,225 (+)	Ensembl

RefSeq Acc Id:

NM_203332 ⟹ NP_976077

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	168,336,501 - 168,340,300 (+)	NCBI
mRatBN7.2	4	166,605,104 - 166,608,903 (+)	NCBI
Rnor_6.0	4	167,419,911 - 167,485,225 (+)	NCBI
Rnor_5.0	4	230,114,339 - 230,114,629 (+)	NCBI
RGSC_v3.4	4	170,578,759 - 170,583,974 (+)	RGD
Celera	4	155,205,716 - 155,209,513 (+)	NCBI

Sequence:

show sequence

CAGTTGGGAGAAAGTCCATAGACTCCTCCAAGATGCTTGTGGTCCTGCTCACAGCAGCCTTGCT
GGCTCTGAGCTCAGCTCAGGGCACGGATGAAGAGGTCAACAATGCTGAGACCAGTGATGTACCA
GCAGATTCTGAACAACAACCCGTGGACTCGGGTTCAGATCCACCTTCTGCTGATGCAGATGCAG
AGAATGTTCAAGAGGGTGAATCAGCCCCACCAGCAAATGAAGAGCCTCCTGCCACCTCTGGGAG
TGAAGAGGAACAGCAGCAGCAGGAACCCACACAGGCAGAGAATCAAGAGCCTCCTGCCACCTCT
GGGAGTGAAGAGGAACAGCAGCAGCAGGAACCCACACAGGCAGAGAATCAAGAGCCTCCTGCCA
CCTCTGGGAGTGAAGAGGAACAGCAGCAGCAGCAACCCACACAGGCAGAGAATCAAGAGCCTCC
TGCCACCTCTGGGAGTGAAGAGGAACAGCAGCAGCAGGAATCCACACAGGCAGAGAATCAAGAG
CCTTCTGACTCTGCTGGGGAAGGACAGGAAACTCAACCTGAGGAAGGAAATGTAGAGTCACCTC
CCTCTTCTCCTGAAAACTCACAAGAACAACCACAGCAAACAAATCCAGAGGAGAAACCGCCTGC
TCCTAAGACTCAGGAAGAGCCACAGCACTATAGAGGTCGTCCTCCAAAGAAGATTTTTCCTTTT
TTCATTTACAGAGGAAGACCAGTAGTAGTATTCAGGCTCGAGCCTAGGAATCCATTCGCCAGAA
GATTTTAGAGAGTACCTGAGAAGATTATGACCTTCAGATGTGTAGGTCAACAAATCACTGTTGA
TTGTCTATAATATTCCAATAAAAATTTTCAGCATGC

hide sequence

Protein Sequences


Protein RefSeqs	NP_976077	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40969	(Get FASTA)	NCBI Sequence Viewer
	AAA40970	(Get FASTA)	NCBI Sequence Viewer
	AAA41279	(Get FASTA)	NCBI Sequence Viewer
	AAF73220	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000035576
GenBank Protein	P08462	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_976077 ⟸ NM_203332
- Peptide Label:	precursor
- UniProtKB:	A6IMC5 (UniProtKB/TrEMBL), A0A0G2K5E1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLVVLLTAALLALSSAQGTDEEVNNAETSDVPADSEQQPVDSGSDPPSADADAENVQEGESAPP ANEEPPATSGSEEEQQQQEPTQAENQEPPATSGSEEEQQQQEPTQAENQEPPATSGSEEEQQQQ QPTQAENQEPPATSGSEEEQQQQESTQAENQEPSDSAGEGQETQPEEGNVESPPSSPENSQEQP QQTNPEEKPPAPKTQEEPQHYRGRPPKKIFPFFIYRGRPVVVFRLEPRNPFARRF hide sequence

Ensembl Acc Id:

ENSRNOP00000035576 ⟸ ENSRNOT00000038396

Ensembl Acc Id:

ENSRNOP00000007659 ⟸ ENSRNOT00000007659

Ensembl Acc Id:

ENSRNOP00000040244 ⟸ ENSRNOT00000046622

Ensembl Acc Id:

ENSRNOP00000073391 ⟸ ENSRNOT00000078821

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P08462-F1-model_v2	AlphaFold	P08462	1-247	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:735181	AgrOrtholog
BioCyc Gene	G2FUF-42671	BioCyc
Ensembl Genes	ENSRNOG00000021313	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000038396	ENTREZGENE
InterPro	Pro-rich	UniProtKB/Swiss-Prot
KEGG Report	rno:120093082	UniProtKB/Swiss-Prot
	rno:360395	UniProtKB/Swiss-Prot
NCBI Gene	360395	ENTREZGENE
PANTHER	BASIC SALIVARY PROLINE-RICH PROTEIN 1-RELATED	UniProtKB/Swiss-Prot
	PTHR23203	UniProtKB/Swiss-Prot
Pfam	Pro-rich	UniProtKB/Swiss-Prot
PhenoGen	Prr4	PhenoGen
RatGTEx	ENSRNOG00000021313	RatGTEx
SMART	Pro-rich	UniProtKB/Swiss-Prot
UniProt	A0A0G2K5E1	ENTREZGENE, UniProtKB/TrEMBL
	A6IMC5	ENTREZGENE, UniProtKB/TrEMBL
	D4A0S3_RAT	UniProtKB/TrEMBL
	F1LSD9_RAT	UniProtKB/TrEMBL
	GRPB_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-03-27	Prr4	proline rich 4	Grpcb	glutamine/glutamic acid-rich protein B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-05-24	Grpcb	glutamine/glutamic acid-rich protein B	LOC100365252	rCG29588-like	Data merged from RGD:2319422	1643240	APPROVED
2010-05-06	Grpcb	glutamine/glutamic acid-rich protein B	Grpcb	glutamine/glutamic acid-rich protein A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-05-05	LOC100365252	rCG29588-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2009-09-17	Grpcb	glutamine/glutamic acid-rich protein A	LOC360395	hypothetical gene supported by M31032; NM_181440	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-09-30	LOC360395				Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message