Advanced Search (OLGA)

Gene: Laptm4a (lysosomal protein transmembrane 4 alpha) Rattus norvegicus

Analyze

Symbol:

Laptm4a

Name:

lysosomal protein transmembrane 4 alpha

RGD ID:

735179

Description:

Predicted to be located in Golgi apparatus and late endosome membrane. Predicted to be active in lysosomal membrane. Orthologous to human LAPTM4A (lysosomal protein transmembrane 4 alpha); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2-methoxyethanol; 4,4'-sulfonyldiphenol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

lysosomal-associated protein transmembrane 4 alpha; lysosomal-associated protein transmembrane 4A; lysosomal-associated transmembrane protein 4A

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	37,438,503 - 37,456,238 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	37,438,121 - 37,456,223 (+)	Ensembl				GRCr8
mRatBN7.2	6	31,719,287 - 31,737,023 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	31,718,976 - 31,737,020 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	32,011,285 - 32,029,021 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	32,327,147 - 32,344,883 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	31,801,757 - 31,819,494 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	34,042,132 - 34,059,960 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	34,028,936 - 34,059,961 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	43,823,229 - 43,841,057 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	32,410,289 - 32,427,917 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	31,167,791 - 31,185,419 (+)	NCBI		Celera
RGSC_v3.1	6	32,413,241 - 32,430,870 (+)	NCBI
Cytogenetic Map	6	q14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-methoxyethanol (EXP)

4,4'-sulfonyldiphenol (EXP)

amphetamine (EXP)

Aroclor 1254 (ISO)

atrazine (EXP,ISO)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

Butylbenzyl phthalate (ISO)

cadmium dichloride (ISO)

calyculin A (ISO)

chrysene (ISO)

deoxynivalenol (ISO)

Dibutyl phosphate (ISO)

doxorubicin (ISO)

folic acid (ISO)

gentamycin (EXP)

ketoconazole (EXP)

lipopolysaccharide (ISO)

nefazodone (EXP)

nimesulide (EXP)

Nivalenol (ISO)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (EXP)

pentachlorophenol (ISO)

phenobarbital (ISO)

pirinixic acid (EXP)

potassium dichromate (ISO)

retinyl acetate (ISO)

sodium arsenite (ISO)

thiram (ISO)

titanium dioxide (ISO)

topotecan (EXP)

triphenyl phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

regulation of lysosomal membrane permeability (IBA)

Cellular Component

endomembrane system (IEA)

Golgi apparatus (IEA,ISO)

late endosome membrane (IEA,ISO,ISS)

lysosomal membrane (IBA,IEA,ISO,ISS)

membrane (IEA,ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Lysosome-associated protein transmembrane 4 alpha (LAPTM4 alpha) requires two tandemly arranged tyrosine-based signals for sorting to lysosomes.	Hogue DL, etal., Biochem J 2002 Aug 1;365(Pt 3):721-30.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:10942595	PMID:15489334	PMID:20080761	PMID:22096579	PMID:22871113

Genomics

Comparative Map Data

Laptm4a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	37,438,503 - 37,456,238 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	37,438,121 - 37,456,223 (+)	Ensembl				GRCr8
mRatBN7.2	6	31,719,287 - 31,737,023 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	31,718,976 - 31,737,020 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	32,011,285 - 32,029,021 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	32,327,147 - 32,344,883 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	31,801,757 - 31,819,494 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	34,042,132 - 34,059,960 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	34,028,936 - 34,059,961 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	43,823,229 - 43,841,057 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	32,410,289 - 32,427,917 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	31,167,791 - 31,185,419 (+)	NCBI		Celera
RGSC_v3.1	6	32,413,241 - 32,430,870 (+)	NCBI
Cytogenetic Map	6	q14	NCBI

LAPTM4A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	20,032,650 - 20,051,628 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	20,032,649 - 20,051,693 (-)	Ensembl			hg38	GRCh38
GRCh37	2	20,232,411 - 20,251,389 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	20,095,894 - 20,114,926 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	2	20,154,040 - 20,173,073	NCBI
Celera	2	20,094,750 - 20,114,129 (-)	NCBI		Celera
Cytogenetic Map	2	p24.1	NCBI
HuRef	2	19,989,688 - 20,009,087 (-)	NCBI		HuRef
CHM1_1	2	20,161,760 - 20,181,158 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	20,066,155 - 20,085,173 (-)	NCBI		T2T-CHM13v2.0

Laptm4a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	8,972,072 - 8,988,742 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	8,971,598 - 8,988,742 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	12	8,921,307 - 8,938,742 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	8,921,664 - 8,938,742 (+)	Ensembl			mm10	GRCm38
MGSCv37	12	8,928,113 - 8,945,548 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	12	8,947,419 - 8,964,736 (+)	NCBI		MGSCv36	mm8
Celera	12	9,304,882 - 9,322,098 (+)	NCBI		Celera
Cytogenetic Map	12	A1.1	NCBI
cM Map	12	3.96	NCBI

Laptm4a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955469	2,604,464 - 2,627,043 (-)	Ensembl
ChiLan1.0	NW_004955469	2,604,464 - 2,626,835 (-)	NCBI	ChiLan1.0	ChiLan1.0

LAPTM4A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	106,473,385 - 106,495,128 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	106,477,357 - 106,499,100 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	20,019,774 - 20,038,289 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	20,135,960 - 20,154,667 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	20,135,960 - 20,154,667 (-)	Ensembl			panPan2	panpan1.1

LAPTM4A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	15,066,326 - 15,081,562 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	15,066,885 - 15,080,752 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	15,026,395 - 15,043,908 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	15,214,034 - 15,231,554 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	15,214,035 - 15,231,476 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	15,067,635 - 15,085,234 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	15,074,180 - 15,091,684 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	15,105,848 - 15,123,371 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Laptm4a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	59,503,393 - 59,519,963 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936493	11,319,286 - 11,336,910 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936493	11,319,923 - 11,336,204 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LAPTM4A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	118,152,587 - 118,170,278 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	3	118,151,866 - 118,170,279 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	126,183,059 - 126,201,156 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LAPTM4A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	87,668,955 - 87,688,080 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	87,668,710 - 87,690,467 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666045	24,539,687 - 24,558,540 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Laptm4a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624738	2,763,165 - 2,790,289 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624738	2,763,287 - 2,790,244 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Laptm4a
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	7	29,167,234 - 29,185,133 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Laptm4a
65 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	77
Count of miRNA genes:	60
Interacting mature miRNAs:	75
Transcripts:	ENSRNOT00000009665
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
8552962	Pigfal16	Plasma insulin-like growth factor 1 level QTL 16	9.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	6	1975879	46975879	Rat
10401812	Kidm54	Kidney mass QTL 54			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	6	20097635	65097635	Rat
8552910	Pigfal5	Plasma insulin-like growth factor 1 level QTL 5	4.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	6	22653889	67653889	Rat
10401800	Kidm49	Kidney mass QTL 49			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	6	20097635	65097635	Rat
1300164	Rf15	Renal function QTL 15	3.12		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	3239989	48239989	Rat
1331779	Rf38	Renal function QTL 38	2.876		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	31185002	76185002	Rat
9589129	Insul24	Insulin level QTL 24	19.06	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	6	1975879	46975879	Rat
7411603	Foco13	Food consumption QTL 13	5.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	6	1975879	46975879	Rat
1598843	Cm63	Cardiac mass QTL 63	2.6		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	1	44788383	Rat
7411542	Bw127	Body weight QTL 127	5.5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	1975879	46975879	Rat
2292616	Ept15	Estrogen-induced pituitary tumorigenesis QTL 15	4.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	6	1	44788383	Rat
9589048	Scfw3	Subcutaneous fat weight QTL 3	4.57	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	6	1975879	46975879	Rat
2293839	Kiddil2	Kidney dilation QTL 2	4.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	26618314	86868070	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	20859430	113082285	Rat
2301964	Bp323	Blood pressure QTL 323	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	1	86868070	Rat
2293709	Bss23	Bone structure and strength QTL 23	5.18	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	6	3239989	48239989	Rat
2293650	Bss31	Bone structure and strength QTL 31	5.05	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	6	3239989	48239989	Rat
1578665	Bss16	Bone structure and strength QTL 16	4.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	6	33328841	78328841	Rat
2293841	Kiddil4	Kidney dilation QTL 4	4.4		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	26618314	86868070	Rat
1300128	Rf16	Renal function QTL 16	3.89		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	1	40163351	Rat
1641898	Colcr4	Colorectal carcinoma resistance QTL4	3.71	0.0007	intestine integrity trait (VT:0010554)	well differentiated malignant colorectal tumor surface area measurement (CMO:0002077)	6	30937632	75937632	Rat
1578668	Bmd14	Bone mineral density QTL 14	3.8		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	6	33328841	78328841	Rat
70199	Coreg1	Compensatory renal growth QTL 1	11.8		kidney mass (VT:0002707)	compensatory renal growth score (CMO:0001894)	6	14599473	63457687	Rat
2301972	Bp325	Blood pressure QTL 325	4.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	16089372	61967788	Rat
1358190	Ept1	Estrogen-induced pituitary tumorigenesis QTL 1	4.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	6	1	44788383	Rat
2293656	Bss28	Bone structure and strength QTL 28	6.79	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	6	3239989	48239989	Rat
1354664	Slep2	Serum leptin concentration QTL 2	4.49		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	6	22288257	67288257	Rat

Markers in Region

BI292974

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	31,734,314 - 31,734,509 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	34,057,268 - 34,057,462	NCBI	Rnor6.0
Rnor_5.0	6	43,838,365 - 43,838,559	UniSTS	Rnor5.0
RGSC_v3.4	6	32,425,225 - 32,425,419	UniSTS	RGSC3.4
Celera	6	31,182,727 - 31,182,921	UniSTS
Cytogenetic Map	6	q14	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_199384	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC123473	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC063179	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212732	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213363	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229677	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232171	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232930	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ235113	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000009665 ⟹ ENSRNOP00000009665

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	31,719,339 - 31,737,004 (+)	Ensembl
Rnor_6.0 Ensembl	6	34,042,130 - 34,059,960 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000085797 ⟹ ENSRNOP00000070019

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	37,438,121 - 37,455,475 (+)	Ensembl
mRatBN7.2 Ensembl	6	31,718,976 - 31,736,260 (+)	Ensembl
Rnor_6.0 Ensembl	6	34,028,936 - 34,059,961 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000091651 ⟹ ENSRNOP00000075537

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	37,438,121 - 37,456,223 (+)	Ensembl
mRatBN7.2 Ensembl	6	31,718,976 - 31,737,020 (+)	Ensembl
Rnor_6.0 Ensembl	6	34,030,620 - 34,059,961 (+)	Ensembl

RefSeq Acc Id:

NM_199384 ⟹ NP_955416

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	37,438,503 - 37,456,238 (+)	NCBI
mRatBN7.2	6	31,719,287 - 31,737,023 (+)	NCBI
Rnor_6.0	6	34,042,132 - 34,059,960 (+)	NCBI
Rnor_5.0	6	43,823,229 - 43,841,057 (+)	NCBI
RGSC_v3.4	6	32,410,289 - 32,427,917 (+)	RGD
Celera	6	31,167,791 - 31,185,419 (+)	RGD

Sequence:

show sequence

AGAGTCGTCTGGGTTGAACCGCTGGGCCGAAAGCTTTTGTCAGGGGCCTGGGCGAGAGCGAGGC
CCACGAGGTTCCCGATGGTGTCCATGACTTTCAAACGGAGCCGCAGCGACCGGTTCTACAGCAC
CCGGTGCTGCGGCTGTTGCCATGTCCGCACCGGGACGATCATCCTGGGGACCTGGTACATGGTG
GTCAACCTATTGATGGCAATTTTGCTGACTGTGGAGGTGACTCATCCAAATTCCATGCCAGCTG
TCAACATTCAGTATGAAGTCATTGGTAATTACTATTCATCTGAGAGAATGGCTGATAATGCCTG
CGTTCTTTTTGCCGTCTCTGTTCTTATGTTTATAATCAGTTCAATGCTGGTTTATGGAGCCATT
TCTTATCAAGTGGGCTGGCTGATTCCTTTCTTCTGCTACCGACTTTTTGACTTCGTTCTCAGTT
GTCTGGTAGCCATCAGTTCTCTCACTTACTTGCCAAGAATCAAAGAATATCTGGATCAGTTGCC
TGATTTCCCCTACAAAGATGACCTCCTGGCATTGGACTCCAGCTGCCTTCTGTTCATTGTACTT
GTGTTCTTTGTGGTATTCATCATTTTTAAGGCTTACCTAATCAATTGTGTTTGGAACTGCTACA
AATACATCAACAATAGAAATGTGCCAGAGATTGCCGTGTATCCTGCCTTTGAAGCACCTCCACA
GTACGTTTTGCCAACCTATGAAATGGCTGTGAAGATTCCTGAGAAAGAGCCACCACCTCCTTAC
CTGCCTGCCTGAGGACGTTCTACCTTGTCAATAAAGCCTATACCAGCTTCTTGTCTTGTTTATT
TTACAGAAAGCTGCAATGCAGGGCTCTCAGACTCGTTTGATGTAAAGTGCACTGTCTTGTCTGA
GCATTTATTTTCAAACACTAAGGAGCTTTTGGACATTATTAAAAATTTTGTTAAGAATCACATT
GTAGAAACTTTTGAAGACAATCTAGGTTAAGCAAGAGCAAAGTGCCATTGTTAGCCTTTAACTG
AGGGTAGGGAGGGGAAGGGTCTCTATGTTTTCTTTTTTAACTTTGCACTTTCTTTGTATAATGG
TTTATGTTTTGGATGTCTGATGCCCTGAATAGTTTCCAGAGAGTGAGTTGGTCGAAGATCCGCA
GTCTCCAGCTCTGTGAAACAGGAGAGAGAAAGAGCATTTTGACTTGACCTGGAAGATGACGGTT
GCATGCTTCTCATTTGTATGTTTTCATCTTTGTGATAAAATGCTTTAATAAAGCTCTTAAATTT
CAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_955416	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH63179	(Get FASTA)	NCBI Sequence Viewer
	EDM03082	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000009665.5
GenBank Protein	Q6P501	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_955416 ⟸ NM_199384

- UniProtKB:

Q6P501 (UniProtKB/Swiss-Prot), A0A0G2JWU5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVSMTFKRSRSDRFYSTRCCGCCHVRTGTIILGTWYMVVNLLMAILLTVEVTHPNSMPAVNIQY
EVIGNYYSSERMADNACVLFAVSVLMFIISSMLVYGAISYQVGWLIPFFCYRLFDFVLSCLVAI
SSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFVVFIIFKAYLINCVWNCYKYINN
RNVPEIAVYPAFEAPPQYVLPTYEMAVKIPEKEPPPPYLPA

hide sequence

Ensembl Acc Id:

ENSRNOP00000070019 ⟸ ENSRNOT00000085797

Ensembl Acc Id:

ENSRNOP00000009665 ⟸ ENSRNOT00000009665

Ensembl Acc Id:

ENSRNOP00000075537 ⟸ ENSRNOT00000091651

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6P501-F1-model_v2	AlphaFold	Q6P501	1-233	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694486

Promoter ID:

EPDNEW_R5011

Type:

initiation region

Name:

Laptm4a_1

Description:

lysosomal protein transmembrane 4 alpha

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	34,042,098 - 34,042,158	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:735179	AgrOrtholog
BioCyc Gene	G2FUF-38173	BioCyc
Ensembl Genes	ENSRNOG00000006865	Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000009665.7	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:6890564	IMAGE-MGC_LOAD
InterPro	LAPTM4/5	UniProtKB/Swiss-Prot
	LAPTM_4A/5	UniProtKB/Swiss-Prot
	LAPTM_transporter	UniProtKB/Swiss-Prot
KEGG Report	rno:298875	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72951	IMAGE-MGC_LOAD
NCBI Gene	298875	ENTREZGENE
PANTHER	LYSOSOMAL-ASSOCIATED TRANSMEMBRANE PROTEIN	UniProtKB/Swiss-Prot
	LYSOSOMAL-ASSOCIATED TRANSMEMBRANE PROTEIN 4A	UniProtKB/Swiss-Prot
Pfam	Mtp	UniProtKB/Swiss-Prot
PhenoGen	Laptm4a	PhenoGen
RatGTEx	ENSRNOG00000006865	RatGTEx
UniProt	A0A0G2JWU5	ENTREZGENE, UniProtKB/TrEMBL
	A0A0G2KAV0_RAT	UniProtKB/TrEMBL
	A6HAM7_RAT	UniProtKB/TrEMBL
	LAP4A_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-11-11	Laptm4a	lysosomal protein transmembrane 4 alpha	Laptm4a	lysosomal-associated protein transmembrane 4A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-07-08	Laptm4a	lysosomal-associated protein transmembrane 4A		lysosomal-associated protein transmembrane 4 alpha	Name updated	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message