Advanced Search (OLGA)

Gene: Tmbim4 (transmembrane BAX inhibitor motif containing 4) Rattus norvegicus

Analyze

Symbol:

Tmbim4

Name:

transmembrane BAX inhibitor motif containing 4

RGD ID:

735173

Description:

Predicted to enable calcium channel activity. Predicted to be involved in several processes, including endoplasmic reticulum unfolded protein response; negative regulation of neuron apoptotic process; and regulation of calcium-mediated signaling. Predicted to be located in Golgi stack and endoplasmic reticulum membrane. Predicted to be active in membrane. Orthologous to human TMBIM4 (transmembrane BAX inhibitor motif containing 4); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; flutamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

CGI-119 protein; Cgi119; MGC73002; transmembrane BAX inhibitor motif-containing protein 4; Unknown (protein for MGC:73002)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	57,604,275 - 57,618,861 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	57,604,275 - 57,621,056 (+)	Ensembl				GRCr8
mRatBN7.2	7	55,718,690 - 55,733,277 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	55,718,699 - 55,742,773 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	57,625,111 - 57,639,700 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	59,828,292 - 59,842,883 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	59,605,633 - 59,620,225 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	64,987,859 - 65,002,447 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	64,987,859 - 65,002,455 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	65,206,720 - 65,221,308 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	59,473,341 - 59,487,931 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	52,474,084 - 52,488,667 (+)	NCBI		Celera
RGSC_v3.1	7	59,494,073 - 59,508,661 (+)	NCBI
Cytogenetic Map	7	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

ovarian cyst (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

all-trans-retinoic acid (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

Butylbenzyl phthalate (ISO)

casticin (ISO)

cisplatin (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

cyproconazole (ISO)

dexamethasone (ISO)

dicrotophos (ISO)

dioxygen (ISO)

diuron (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

etoposide (ISO)

flutamide (EXP)

folic acid (ISO)

gentamycin (EXP)

indometacin (ISO)

leflunomide (ISO)

methyl methanesulfonate (ISO)

mitomycin C (ISO)

nitrates (ISO)

paracetamol (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

propanal (ISO)

propiconazole (ISO)

quercetin (ISO)

sunitinib (ISO)

temozolomide (ISO)

thapsigargin (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

tunicamycin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

calcium ion transmembrane transport (IEA)

endoplasmic reticulum unfolded protein response (IBA)

locomotory behavior (IEA,ISO)

negative regulation of apoptotic process (IEA,ISO)

negative regulation of neuron apoptotic process (IEA,ISO)

regulation of calcium-mediated signaling (IEA,ISO)

Cellular Component

endoplasmic reticulum membrane (IEA,ISO)

Golgi apparatus (IEA,ISO)

Golgi stack (IEA,ISO)

membrane (IBA,IEA)

Molecular Function

calcium channel activity (IBA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:17319741	PMID:19553469

Genomics

Comparative Map Data

Tmbim4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	57,604,275 - 57,618,861 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	57,604,275 - 57,621,056 (+)	Ensembl				GRCr8
mRatBN7.2	7	55,718,690 - 55,733,277 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	55,718,699 - 55,742,773 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	57,625,111 - 57,639,700 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	59,828,292 - 59,842,883 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	59,605,633 - 59,620,225 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	64,987,859 - 65,002,447 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	64,987,859 - 65,002,455 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	65,206,720 - 65,221,308 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	59,473,341 - 59,487,931 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	52,474,084 - 52,488,667 (+)	NCBI		Celera
RGSC_v3.1	7	59,494,073 - 59,508,661 (+)	NCBI
Cytogenetic Map	7	q22	NCBI

TMBIM4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	66,135,846 - 66,169,996 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	66,135,846 - 66,170,027 (-)	Ensembl			hg38	GRCh38
GRCh37	12	66,529,626 - 66,563,776 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	64,816,984 - 64,850,074 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	12	66,194,786 - 66,228,037 (-)	NCBI		Celera
Cytogenetic Map	12	q14.3	NCBI
HuRef	12	63,581,354 - 63,614,468 (-)	NCBI		HuRef
CHM1_1	12	66,497,573 - 66,530,663 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	66,115,352 - 66,149,503 (-)	NCBI		T2T-CHM13v2.0

Tmbim4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	120,044,731 - 120,060,802 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	120,037,495 - 120,060,822 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	10	120,208,826 - 120,224,897 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	120,201,590 - 120,224,917 (+)	Ensembl			mm10	GRCm38
MGSCv37	10	119,645,882 - 119,661,953 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	10	119,611,886 - 119,627,957 (+)	NCBI		MGSCv36	mm8
Celera	10	122,570,626 - 122,587,068 (+)	NCBI		Celera
Cytogenetic Map	10	D2	NCBI
cM Map	10	67.94	NCBI

Tmbim4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955458	12,795,445 - 12,818,277 (-)	Ensembl
ChiLan1.0	NW_004955458	12,795,484 - 12,818,277 (-)	NCBI	ChiLan1.0	ChiLan1.0

TMBIM4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	28,185,329 - 28,218,615 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	28,182,105 - 28,215,384 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	22,739,658 - 22,773,228 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	23,246,329 - 23,279,160 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	23,246,329 - 23,279,160 (+)	Ensembl			panPan2	panpan1.1

TMBIM4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	8,643,982 - 8,670,948 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	8,575,311 - 8,602,280 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	8,756,350 - 8,783,338 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	8,753,197 - 8,783,353 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	8,632,641 - 8,659,591 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	8,878,118 - 8,905,130 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	8,999,868 - 9,026,838 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Tmbim4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	49,885,050 - 49,902,779 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936545	4,207,342 - 4,225,158 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936545	4,207,344 - 4,225,071 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TMBIM4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	30,488,328 - 30,511,533 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	5	30,488,319 - 30,511,558 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	33,729,166 - 33,785,099 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TMBIM4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	61,817,688 - 61,850,747 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	61,815,738 - 61,850,716 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	183,873,879 - 183,906,897 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tmbim4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624802	2,137,612 - 2,173,854 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624802	2,137,580 - 2,172,402 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Tmbim4
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	198,185,541 - 198,200,747 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Tmbim4
249 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	8
Count of miRNA genes:	6
Interacting mature miRNAs:	8
Transcripts:	ENSRNOT00000005694
Prediction methods:	Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7411569	Bw137	Body weight QTL 137		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	23807606	68807606	Rat
10053722	Scort27	Serum corticosterone level QTL 27	2.41	0.0083	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	45113903	90113903	Rat
1578652	Bmd15	Bone mineral density QTL 15	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	7	10517086	62346019	Rat
1549840	Bss5	Bone structure and strength QTL 5	9.8		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	7	26638057	71638057	Rat
1357336	Gluco6	Glucose level QTL 6	3.4		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	7	51700643	96700643	Rat
1300127	Srn1	Serum renin concentration QTL 1	3.87		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	7	24179478	86817926	Rat
10059605	Kidm47	Kidney mass QTL 47	2.91	0.05	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	49137999	67614020	Rat
1358361	Sradr5	Stress Responsive Adrenal Weight QTL 5	5.55		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	7	31770293	110435881	Rat
1298525	Cm1	Cardiac mass QTL 1	2.7		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	7	56625161	101625161	Rat
2298547	Neuinf5	Neuroinflammation QTL 5	3.7		nervous system integrity trait (VT:0010566)	spinal cord Cd74 protein level (CMO:0002131)	7	10112916	60150541	Rat
631513	Scl7	Serum cholesterol level QTL 7	4.1		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	39845902	84845902	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	46307490	127866166	Rat
10755453	Coatc12	Coat color QTL 12		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	32998702	77998702	Rat
2317059	Aia15	Adjuvant induced arthritis QTL 15	2.46		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	49682832	63890004	Rat
1300151	Bp181	Blood pressure QTL 181	3.36		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	7	55498584	105834451	Rat
7411605	Foco14	Food consumption QTL 14	24.1	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	36178764	81178764	Rat
738030	Anxrr8	Anxiety related response QTL 8	4.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	48475049	93475049	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	10112916	99900612	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	1	104117804	Rat
631534	Lnnr1	Liver neoplastic nodule remodeling QTL 1	3.85	0.001	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	7	36178764	81178764	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	1509236	116977875	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	40540077	123682549	Rat
2303629	Vencon3	Ventilatory control QTL 3	7.25		respiration trait (VT:0001943)	respiration rate (CMO:0000289)	7	42996226	58678836	Rat
70190	Mcs6	Mammary carcinoma susceptibility QTL 6	2.29		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	7	28624575	65788017	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	49682832	115766396	Rat
1300132	Bp182	Blood pressure QTL 182	3.49		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	21541977	86817926	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	49682832	115766396	Rat
738033	Anxrr6	Anxiety related response QTL 6	4.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	7	17460447	62460447	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	49682832	115766396	Rat
2303582	Gluco53	Glucose level QTL 53	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	7	48603087	93603087	Rat
70207	Niddm31	Non-insulin dependent diabetes mellitus QTL 31	3.9		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	7	20057232	65057232	Rat
61439	Cia8	Collagen induced arthritis QTL 8	5.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	7	27182914	72182914	Rat

Markers in Region

RH134333

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	7	57,617,871 - 57,618,705 (+)	Marker Load Pipeline
mRatBN7.2	7	55,732,287 - 55,733,121 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	65,001,458 - 65,002,291	NCBI	Rnor6.0
Rnor_5.0	7	65,220,319 - 65,221,152	UniSTS	Rnor5.0
RGSC_v3.4	7	59,486,942 - 59,487,775	UniSTS	RGSC3.4
Celera	7	52,487,678 - 52,488,511	UniSTS
RH 3.4 Map	7	479.01	UniSTS
Cytogenetic Map	7	q22	UniSTS

RH139228

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	7	57,617,871 - 57,618,749 (+)	Marker Load Pipeline
mRatBN7.2	7	55,732,287 - 55,733,165 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	65,001,458 - 65,002,335	NCBI	Rnor6.0
Rnor_5.0	7	65,220,319 - 65,221,196	UniSTS	Rnor5.0
RGSC_v3.4	7	59,486,942 - 59,487,819	UniSTS	RGSC3.4
Celera	7	52,487,678 - 52,488,555	UniSTS
RH 3.4 Map	7	478.61	UniSTS
Cytogenetic Map	7	q22	UniSTS

UniSTS:236473

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	55,719,213 - 55,719,347 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	64,988,383 - 64,988,516	NCBI	Rnor6.0
Rnor_5.0	7	65,207,244 - 65,207,377	UniSTS	Rnor5.0
RGSC_v3.4	7	59,473,865 - 59,473,998	UniSTS	RGSC3.4
Celera	7	52,474,608 - 52,474,741	UniSTS
Cytogenetic Map	7	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_199116	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC060596	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473960	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217672	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230396	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233689	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000005694 ⟹ ENSRNOP00000005694

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	57,604,275 - 57,621,056 (+)	Ensembl
mRatBN7.2 Ensembl	7	55,718,699 - 55,742,773 (+)	Ensembl
Rnor_6.0 Ensembl	7	64,987,859 - 65,002,455 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000115970 ⟹ ENSRNOP00000078812

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	55,725,219 - 55,742,773 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000144397 ⟹ ENSRNOP00000102989

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	57,604,290 - 57,619,622 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000158531 ⟹ ENSRNOP00000099390

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	57,604,275 - 57,614,183 (+)	Ensembl

RefSeq Acc Id:

NM_199116 ⟹ NP_954547

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	57,604,275 - 57,618,861 (+)	NCBI
mRatBN7.2	7	55,718,690 - 55,733,277 (+)	NCBI
Rnor_6.0	7	64,987,859 - 65,002,447 (+)	NCBI
Rnor_5.0	7	65,206,720 - 65,221,308 (+)	NCBI
RGSC_v3.4	7	59,473,341 - 59,487,931 (+)	RGD
Celera	7	52,474,084 - 52,488,667 (+)	RGD

Sequence:

show sequence

GGGACTCCCGGAAGTGGGTGAAGGCGGTTGTGGTCAGTGTAGGCAGGTGCAGCTGCTACTGACG
ACATGGCTGATACGGACCCGCGCTATCCCCGCTCTTCCATCGAGGATGACTTCAACTATGGCAG
CTGCGTGGCGTCGGCCAGCGTGCACATTCGCATGGCCTTTCTCAGGAAAGTCTACAGCATCCTG
TCTCTGCAAGTTCTCCTAACGACAGTGACCTCTGCCCTGTTCCTGTATTTCGAAACCTTGCGTA
CTTTTGTCCATGACAGCCCTGCCTTAATTGTGGTGTTTGCTCTCGGATCTCTGGGCTTGATCTT
TGCGTTGACTCTGCACAGACACACGCATCCTCTGAACCTCTATCTGCTTTTTGCATTTACACTG
TCAGAAGCCCTGACCGTGGCAACTGTTGTTACTTTCTATGATGGGCATCTGGTTCTGCATGCGT
TTATACTGACTGCTGCAGTCTTTCTTGGCTTGACTGCCTATACTCTACAATCAAAGAGAGATTT
CAGCAAATTCGGAGCAGGGCTGTTTGCTTGTTTATGGATTTTGTGCCTGGCAGGATTCTTGAAG
GTGTTCTTTTATAGTCAGACGGTGGAACTGGTCTTGGCCTCTCTAGGTGCCCTCCTCTTCTGTG
GATTCATCATCTATGACACACACTCGCTGATGCACAGACTCTCACCTGAAGAGTACGTGTTGGC
TGCCATCAGTCTCTACTTGGATATCATCAATCTCTTCCTGCACCTGCTGAAGTTTCTGGACGCA
GTTAATAAAAAGTAACTGAACAGTATTCAGAGACAGTTTTATTATGAAAAAAGTTTGAATTATA
CTTAAGTATTAAAAGCATTTGTGATCTTTAACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_954547	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH60596	(Get FASTA)	NCBI Sequence Viewer
	EDM16571	(Get FASTA)	NCBI Sequence Viewer
	EDM16572	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000005694.5
	ENSRNOP00000099390.1
	ENSRNOP00000102989
	ENSRNOP00000102989.1

RefSeq Acc Id:

NP_954547 ⟸ NM_199116

- UniProtKB:

Q6P9T9 (UniProtKB/TrEMBL), F6WCM7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MADTDPRYPRSSIEDDFNYGSCVASASVHIRMAFLRKVYSILSLQVLLTTVTSALFLYFETLRT
FVHDSPALIVVFALGSLGLIFALTLHRHTHPLNLYLLFAFTLSEALTVATVVTFYDGHLVLHAF
ILTAAVFLGLTAYTLQSKRDFSKFGAGLFACLWILCLAGFLKVFFYSQTVELVLASLGALLFCG
FIIYDTHSLMHRLSPEEYVLAAISLYLDIINLFLHLLKFLDAVNKK

hide sequence

Ensembl Acc Id:

ENSRNOP00000005694 ⟸ ENSRNOT00000005694

Ensembl Acc Id:

ENSRNOP00000078812 ⟸ ENSRNOT00000115970

Ensembl Acc Id:

ENSRNOP00000102989 ⟸ ENSRNOT00000144397

Ensembl Acc Id:

ENSRNOP00000099390 ⟸ ENSRNOT00000158531

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6P9T9-F1-model_v2	AlphaFold	Q6P9T9	1-238	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695234

Promoter ID:

EPDNEW_R5759

Type:

initiation region

Name:

Tmbim4_1

Description:

transmembrane BAX inhibitor motif containing 4

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	64,987,894 - 64,987,954	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:735173	AgrOrtholog
BioCyc Gene	G2FUF-33913	BioCyc
Ensembl Genes	ENSRNOG00000004312	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000005694.7	UniProtKB/TrEMBL
	ENSRNOT00000144397	ENTREZGENE
	ENSRNOT00000144397.1	UniProtKB/TrEMBL
	ENSRNOT00000158531.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:6889044	IMAGE-MGC_LOAD
InterPro	Bax_inhibitor-1-related	UniProtKB/TrEMBL
KEGG Report	rno:362884	UniProtKB/TrEMBL
MGC_CLONE	MGC:73002	IMAGE-MGC_LOAD
NCBI Gene	362884	ENTREZGENE
PANTHER	PROTEIN LIFEGUARD 4	UniProtKB/TrEMBL
	UPF0005	UniProtKB/TrEMBL
Pfam	Bax1-I	UniProtKB/TrEMBL
PhenoGen	Tmbim4	PhenoGen
RatGTEx	ENSRNOG00000004312	RatGTEx
UniProt	A0ABK0LF25_RAT	UniProtKB/TrEMBL
	A0ABK0LRB3_RAT	UniProtKB/TrEMBL
	A6IGX7_RAT	UniProtKB/TrEMBL
	F6WCM7	ENTREZGENE, UniProtKB/TrEMBL
	Q6P9T9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Tmbim4	transmembrane BAX inhibitor motif containing 4	Cgi119	CGI-119 protein	Symbol and Name updated	1299863	APPROVED
2005-07-08	Cgi119	CGI-119 protein	MGC73002	Unknown (protein for MGC:73002)	Symbol and Name updated	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD