Rpl3 (ribosomal protein L3) - Rat Genome Database

Name: Rpl3
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Rpl3 (ribosomal protein L3) Rattus norvegicus

Analyze

Symbol:

Rpl3

Name:

ribosomal protein L3

RGD ID:

735105

Description:

Enables 5S rRNA binding activity. Predicted to be involved in translation. Predicted to act upstream of or within cellular response to interleukin-4. Located in ribosome. Part of cytosolic large ribosomal subunit. Is active in synapse. Orthologous to human RPL3 (ribosomal protein L3); PARTICIPATES IN ribosome biogenesis pathway; translation pathway; INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

60S ribosomal protein L3; L4; large ribosomal subunit protein uL3; MGC72934

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RPL3 (ribosomal protein L3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rpl3 (ribosomal protein L3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rpl3 (ribosomal protein L3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RPL3 (ribosomal protein L3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RPL3 (ribosomal protein L3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rpl3 (ribosomal protein L3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RPL3 (ribosomal protein L3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RPL3 (ribosomal protein L3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rpl3 (ribosomal protein L3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RPL3L (ribosomal protein L3 like)	HGNC	OrthoDB
Homo sapiens (human):	TLCD3B (TLC domain containing 3B)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Rpl3 (ribosomal protein L3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	RPL3 (ribosomal protein L3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rpl3 (ribosomal protein L3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rpl-3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RPL3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	RpL3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rpl3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	113,491,943 - 113,508,115 (-)	NCBI		GRCr8
mRatBN7.2	7	111,622,255 - 111,627,640 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	111,621,610 - 111,636,468 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	113,370,376 - 113,375,752 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	115,593,924 - 115,599,300 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	115,563,278 - 115,568,654 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	121,297,365 - 121,302,739 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	121,297,355 - 121,311,565 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	121,287,079 - 121,292,461 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	118,314,537 - 118,319,911 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	118,348,766 - 118,354,141 (-)	NCBI
Celera	7	107,950,549 - 107,955,923 (-)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adenylosuccinase lyase deficiency (ISO)

Animal Mammary Neoplasms (ISO)

carcinoma (ISO)

Experimental Mammary Neoplasms (ISO)

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP)

17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

2-amino-14,16-dimethyloctadecan-3-ol (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

4-hydroxyphenyl retinamide (ISO)

5-fluorouracil (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

amiodarone (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzbromarone (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

Brodifacoum (EXP)

C60 fullerene (EXP)

caffeine (ISO)

carbamazepine (ISO)

chloropicrin (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

clofibrate (EXP)

clofibric acid (EXP)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

decabromodiphenyl ether (ISO)

deguelin (ISO)

diarsenic trioxide (ISO)

dioxygen (ISO)

doxorubicin (ISO)

enzyme inhibitor (ISO)

epoxiconazole (ISO)

ethanol (ISO)

flutamide (EXP)

gentamycin (EXP)

glafenine (EXP)

indometacin (EXP)

ivermectin (ISO)

L-ethionine (EXP)

lead(0) (ISO)

leflunomide (ISO)

melatonin (ISO)

methotrexate (ISO)

N-nitrosodiethylamine (EXP)

nefazodone (EXP)

nitric oxide (ISO)

omeprazole (EXP)

paracetamol (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP,ISO)

phenethyl isothiocyanate (EXP)

PhIP (EXP)

pirinixic acid (EXP)

pregnenolone 16alpha-carbonitrile (ISO)

pyrimidifen (ISO)

quercetin (EXP)

resveratrol (ISO)

rotenone (EXP,ISO)

S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO)

sodium arsenite (EXP,ISO)

sodium fluoride (ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

trichloroethene (EXP)

tungsten (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

cellular response to interleukin-4 (IEA,ISO)

translation (IBA,IEA)

Cellular Component

cytoplasm (ISO)

cytosol (ISO)

cytosolic large ribosomal subunit (IBA,IDA,IEA,ISO)

cytosolic ribosome (ISO)

nucleolus (IEA,ISO,ISS)

nucleus (IEA)

protein-containing complex (ISO)

ribosome (IDA)

synapse (EXP,IDA)

Molecular Function

5S rRNA binding (IDA)

protein binding (ISO)

RNA binding (IBA,IEA)

structural constituent of ribosome (IBA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

ribosome biogenesis pathway (ISO)

translation pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Structures of the human and Drosophila 80S ribosome.	Anger AM, etal., Nature. 2013 May 2;497(7447):80-5. doi: 10.1038/nature12104.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Selective high-efficiency cross-linking of mammalian ribosomal proteins with cleavable thiol-directed heterobifunctional reagents: identification and binding directions of major protein complexes.	Hultin T Biochim Biophys Acta. 1986 Aug 15;872(3):226-35.
4.	Studies on interaction of 5 S RNA with ribosomal proteins.	Kargel HJ, etal., FEBS Lett. 1987 Aug 10;220(1):126-8.
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation
8.	Information Derived from GenBank Report	RGD, Sept. 2003
9.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
10.	Identification of neighboring protein pairs in rat liver 60S ribosomal subunits cross-linked with dimethyl suberimidate or dimethyl 3,3'-dithiobispropionimidate.	Uchiumi T, etal., J Biochem. 1980 Oct;88(4):1033-44.
11.	Molecular constituents of the postsynaptic density fraction revealed by proteomic analysis using multidimensional liquid chromatography-tandem mass spectrometry.	Yoshimura Y, etal., J Neurochem. 2004 Feb;88(3):759-68.

Additional References at PubMed

PMID:1520347	PMID:6355773	PMID:9798653	PMID:12962325	PMID:15489334	PMID:16791210	PMID:16963496	PMID:20458337	PMID:21423176	PMID:21630459	PMID:21700703	PMID:22082260
PMID:22658674	PMID:22681889	PMID:22871113	PMID:23349634	PMID:24625528	PMID:30053369

Genomics

Comparative Map Data

Rpl3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	113,491,943 - 113,508,115 (-)	NCBI		GRCr8
mRatBN7.2	7	111,622,255 - 111,627,640 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	111,621,610 - 111,636,468 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	113,370,376 - 113,375,752 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	115,593,924 - 115,599,300 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	115,563,278 - 115,568,654 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	121,297,365 - 121,302,739 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	121,297,355 - 121,311,565 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	121,287,079 - 121,292,461 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	118,314,537 - 118,319,911 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	118,348,766 - 118,354,141 (-)	NCBI
Celera	7	107,950,549 - 107,955,923 (-)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

RPL3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	39,312,882 - 39,319,623 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	39,312,882 - 39,320,389 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	22	39,708,887 - 39,715,628 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	38,038,833 - 38,045,616 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	22	38,033,389 - 38,040,128	NCBI
Celera	22	23,511,001 - 23,517,786 (-)	NCBI		Celera
Cytogenetic Map	22	q13.1	NCBI
HuRef	22	22,674,611 - 22,681,396 (-)	NCBI		HuRef
CHM1_1	22	39,667,623 - 39,674,408 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	22	39,783,532 - 39,790,275 (-)	NCBI		T2T-CHM13v2.0

Rpl3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	79,961,993 - 79,967,553 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	79,961,992 - 79,976,069 (-)	Ensembl		GRCm39 Ensembl
GRCm38	15	80,077,781 - 80,083,406 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	80,077,791 - 80,091,868 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	79,908,211 - 79,913,836 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	79,905,050 - 79,910,590 (-)	NCBI		MGSCv36	mm8
Celera	15	82,193,343 - 82,198,955 (-)	NCBI		Celera
Cytogenetic Map	15	E1	NCBI
cM Map	15	37.85	NCBI

Rpl3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	25,217,777 - 25,224,052 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955413	25,217,777 - 25,224,052 (-)	NCBI	ChiLan1.0	ChiLan1.0

RPL3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	23	49,157,320 - 49,164,856 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	22	51,848,731 - 51,855,625 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	22	20,216,370 - 20,223,259 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	22	38,033,480 - 38,040,992 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	22	38,030,039 - 38,040,992 (-)	Ensembl	panpan1.1		panPan2

RPL3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	25,739,089 - 25,745,487 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	25,739,089 - 25,762,501 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	25,675,001 - 25,681,399 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	26,491,206 - 26,497,609 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	26,491,206 - 26,497,608 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	26,204,996 - 26,211,394 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	26,524,659 - 26,531,062 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	26,700,748 - 26,707,146 (+)	NCBI		UU_Cfam_GSD_1.0

Rpl3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	9,288,589 - 9,294,725 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936492	2,299,992 - 2,305,089 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936492	2,299,067 - 2,305,139 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RPL3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	8,922,665 - 8,929,767 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	8,922,697 - 8,929,768 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	6,216,929 - 6,223,999 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RPL3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Vero_WHO_p1.0	NW_023666045	103,820,580 - 103,827,209 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rpl3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624752	9,017,452 - 9,025,832 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624752	9,019,200 - 9,025,626 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rpl3
66 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	68
Count of miRNA genes:	65
Interacting mature miRNAs:	68
Transcripts:	ENSRNOT00000067032
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	44421311	118198041	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	64002457	135012528	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	68938720	113886318	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	68938720	113886318	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	68938720	113886318	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	69736226	117455174	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	69736356	112729554	Rat
634331	Pia17	Pristane induced arthritis QTL 17	4.7		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	7	73829340	130221005	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	80221299	112308525	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	80221299	124373579	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	80221299	125221299	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	81737938	126737938	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	83153392	128153392	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
71114	Niddm14	Non-insulin dependent diabetes mellitus QTL 14	4.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	7	84257275	129257275	Rat
2298475	Eau6	Experimental allergic uveoretinitis QTL 6		0.0029	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	7	84257275	129257275	Rat
1558655	Swd4	Spike wave discharge measurement QTL 4	3.68	0.0002	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge severity grade (CMO:0001988)	7	86983365	131983365	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	90482196	135012528	Rat
2299163	Iddm34	Insulin dependent diabetes mellitus QTL 34	2.71		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	7	91281130	135012528	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	91412594	129807172	Rat
2313102	Bmd79	Bone mineral density QTL 79	2.3	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	7	94811085	116738842	Rat
1357336	Gluco6	Glucose level QTL 6	3.4		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	7	94811326	116294265	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	96670164	135012528	Rat
1331731	Bp216	Blood pressure QTL 216	2.851		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	102297359	133492884	Rat
70159	Bp61	Blood pressure QTL 61		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	103146217	116738842	Rat
731174	Uae23	Urinary albumin excretion QTL 23	2.4	0.0042	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	7	104603555	135012528	Rat
2306821	Bp335	Blood pressure QTL 335		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	106571501	135012528	Rat
631663	Bw6	Body weight QTL 6	3.4		body mass (VT:0001259)	body weight (CMO:0000012)	7	111075573	134976056	Rat
1300112	Bp183	Blood pressure QTL 183	3.51		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	111182207	135012528	Rat

Markers in Region

BI283926

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	111,622,786 - 111,623,863 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	121,297,887 - 121,298,963	NCBI	Rnor6.0
Rnor_5.0	7	121,287,609 - 121,288,685	UniSTS	Rnor5.0
RGSC_v3.4	7	118,315,059 - 118,316,135	UniSTS	RGSC3.4
Celera	7	107,951,071 - 107,952,147	UniSTS
Cytogenetic Map	7	q34	UniSTS

UniSTS:498308

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	111,624,611 - 111,625,050 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	121,299,712 - 121,300,150	NCBI	Rnor6.0
Rnor_5.0	7	121,289,434 - 121,289,872	UniSTS	Rnor5.0
RGSC_v3.4	7	118,316,884 - 118,317,322	UniSTS	RGSC3.4
Celera	7	107,952,896 - 107,953,334	UniSTS
Cytogenetic Map	7	q34	UniSTS

D14S1219

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	111,624,612 - 111,625,001 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	121,299,713 - 121,300,101	NCBI	Rnor6.0
Rnor_5.0	7	121,289,435 - 121,289,823	UniSTS	Rnor5.0
RGSC_v3.4	7	118,316,885 - 118,317,273	UniSTS	RGSC3.4
Celera	7	107,952,897 - 107,953,285	UniSTS
Cytogenetic Map	7	q34	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High	2		7	2	16	2					4	1
Medium	1	43	50	39	3	39	8	11	74	35	37	10	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_198753	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063263320	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010052961	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010052962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC127784	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC058494	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209477	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211542	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211764	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212671	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213135	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214177	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214350	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214687	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215062	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215305	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218147	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219083	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219302	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219523	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220099	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220378	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220408	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220423	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220830	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221195	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222720	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222993	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223182	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223386	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223514	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225290	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225371	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225405	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225635	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226331	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227897	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228916	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229153	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229505	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229795	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229869	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229906	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230150	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231551	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232038	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232101	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232351	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233196	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234897	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ235165	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000067032 ⟹ ENSRNOP00000060662

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	111,622,255 - 111,627,734 (-)	Ensembl
Rnor_6.0 Ensembl	7	121,297,355 - 121,302,740 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000089407 ⟹ ENSRNOP00000069877

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	111,621,610 - 111,626,925 (-)	Ensembl
Rnor_6.0 Ensembl	7	121,297,414 - 121,302,025 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000092252 ⟹ ENSRNOP00000075786

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	111,626,661 - 111,636,468 (-)	Ensembl
Rnor_6.0 Ensembl	7	121,301,086 - 121,311,565 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000092268

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	7	121,302,507 - 121,303,178 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000092307

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	7	121,301,253 - 121,301,964 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000092507 ⟹ ENSRNOP00000075863

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	7	121,299,706 - 121,302,730 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000092616

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	7	121,300,217 - 121,302,729 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000092716

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	7	121,297,355 - 121,297,794 (-)	Ensembl

RefSeq Acc Id:

NM_198753 ⟹ NP_942048

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	113,502,605 - 113,507,990 (-)	NCBI
mRatBN7.2	7	111,622,255 - 111,627,640 (-)	NCBI
Rnor_6.0	7	121,297,365 - 121,302,739 (-)	NCBI
Rnor_5.0	7	121,287,079 - 121,292,461 (-)	NCBI
RGSC_v3.4	7	118,314,537 - 118,319,911 (-)	RGD
Celera	7	107,950,549 - 107,955,923 (-)	RGD

Sequence:

show sequence

CTCTATCGGCGGCGTGTGGCGGCGAGATGTCTCACAGGAAATTCTCAGCTCCTAGGCATGGGTC
CTTGGGCTTCTTGCCTCGGAAGCGCAGCAGCCGGCATCGTGGAAAAGTGAAGAGCTTCCCTAAG
GATGACCCTTCCAAGCCTGTTCACCTCACAGCCTTCCTAGGGTACAAGGCTGGCATGACCCACA
TTGTCCGGGAAGTTGACCGGCCAGGATCTAAGGTGAATAAGAAAGAAGTTGTGGAGGCTGTGAC
CATTGTGGAAACCCCACCCATGGTGGTTGTGGGTATTGTGGGATATGTAGAAACCCCACGAGGC
CTCCGGACCTTCAAGACTGTATTTGCTGAGCACATCAGCGATGAGTGTAAAAGGCGTTTCTATA
AGAATTGGCACAAATCTAAGAAGAAGGCTTTTACCAAGTACTGTAAGAAATGGCAAGATGACAC
AGGCAAGAAGCAGCTGGAGAAGGACTTCAACAGCATGAAGAAGTACTGCCAGGTCATCCGCATA
ATTGCTCACACTCAGATGCGCCTGCTTCCTCTGCGCCAGAAGAAGGCACACTTGATGGAGATCC
AGGTGAATGGGGGCACTGTAGCTGAGAAGCTAGACTGGGCCCGAGAGAGGCTGGAGCAGCAGGT
CCCTGTGAACCAGGTGTTTGGGCAAGATGAGATGATTGACGTCATCGGCGTGACAAAGGGCAAA
GGCTACAAAGGGGTGACCAGTCGTTGGCATACAAAGAAGCTGCCCCGAAAGACCCACAGAGGTC
TGCGCAAAGTTGCTTGTATTGGAGCTTGGCATCCTGCCCGTGTAGCCTTCTCTGTGGCTCGAGC
TGGGCAGAAAGGCTACCATCACCGAACAGAGATCAACAAGAAGATTTACAAGATTGGTCAAGGC
TACCTCATCAAGGATGGTAAGCTGATCAAGAACAATGCATCTACTGACTACGACCTGTCTGACA
AGAGCATCAACCCACTGGGTGGCTTTGTCCATTATGGTGAGGTGACCAATGACTTCATCATGCT
CAAAGGCTGTGTGGTGGGAACCAAGAAGCGAGTGCTTACTCTCCGGAAGTCCTTGCTGGTCCAG
ACCAAGCGTCGGGCTCTTGAGAAGATTGACCTGAAGTTCATTGACACCACCTCCAAATTCGGAC
ATGGTCGCTTCCAGACCATGGAGGAAAAGAAAGCATTCATGGGACCGCTCAAGAAAGATCGCAT
TGCCAAGGAGGAAGGTGCCTGATGCCAGGAGTACTTTGTGCAGCTGGTGGGGTCTCATCAATAA
AATATTTCCAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063263320 ⟹ XP_063119390

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	113,491,943 - 113,508,115 (-)	NCBI

RefSeq Acc Id:

XR_010052961

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	113,491,943 - 113,508,115 (-)	NCBI

RefSeq Acc Id:

XR_010052962

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	113,491,943 - 113,508,115 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_942048	(Get FASTA)	NCBI Sequence Viewer
	XP_063119390	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH58494	(Get FASTA)	NCBI Sequence Viewer
	EDM15768	(Get FASTA)	NCBI Sequence Viewer
	EDM15769	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000060662
	ENSRNOP00000060662.2
	ENSRNOP00000069877.2
	ENSRNOP00000075786.2
	ENSRNOP00055041306
	ENSRNOP00055041346
	ENSRNOP00060045153
	ENSRNOP00060045176
	ENSRNOP00065047084
	ENSRNOP00065047093
GenBank Protein	P21531	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_942048 ⟸ NM_198753

- UniProtKB:

P21531 (UniProtKB/Swiss-Prot), A6HSV4 (UniProtKB/TrEMBL), A0A8L2QVY8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREVDRPG
SKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYKNWHKSKKK
AFTKYCKKWQDDTGKKQLEKDFNSMKKYCQVIRIIAHTQMRLLPLRQKKAHLMEIQVNGGTVAE
KLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLRKVACIGA
WHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGF
VHYGEVTNDFIMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEE
KKAFMGPLKKDRIAKEEGA

hide sequence

RefSeq Acc Id:

ENSRNOP00000075786 ⟸ ENSRNOT00000092252

RefSeq Acc Id:

ENSRNOP00000060662 ⟸ ENSRNOT00000067032

RefSeq Acc Id:

ENSRNOP00000075863 ⟸ ENSRNOT00000092507

RefSeq Acc Id:

ENSRNOP00000069877 ⟸ ENSRNOT00000089407

RefSeq Acc Id:	XP_063119390 ⟸ XM_063263320
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P21531-F1-model_v2	AlphaFold	P21531	1-403	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695493

Promoter ID:

EPDNEW_R6017

Type:

single initiation site

Name:

Rpl3_1

Description:

ribosomal protein L3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	121,302,739 - 121,302,799	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:735105	AgrOrtholog
BioCyc Gene	G2FUF-32723	BioCyc
Ensembl Genes	ENSRNOG00000016896	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOG00055028945	UniProtKB/Swiss-Prot
	ENSRNOG00060031495	UniProtKB/Swiss-Prot
	ENSRNOG00065033278	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000067032	ENTREZGENE
	ENSRNOT00000067032.4	UniProtKB/TrEMBL
	ENSRNOT00000089407.2	UniProtKB/TrEMBL
	ENSRNOT00000092252.2	UniProtKB/TrEMBL
	ENSRNOT00055050191	UniProtKB/Swiss-Prot
	ENSRNOT00055050245	UniProtKB/Swiss-Prot
	ENSRNOT00060054609	UniProtKB/Swiss-Prot
	ENSRNOT00060054639	UniProtKB/Swiss-Prot
	ENSRNOT00065057226	UniProtKB/Swiss-Prot
	ENSRNOT00065057242	UniProtKB/Swiss-Prot
Gene3D-CATH	3.30.1430.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	4.10.960.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Translation factors	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:6887923	IMAGE-MGC_LOAD
InterPro	L3_arc_euk	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ribosomal_L3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ribosomal_L3_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ribosomal_L3_dom_3_arc_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Transl_B-barrel_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:300079	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:72934	IMAGE-MGC_LOAD
NCBI Gene	300079	ENTREZGENE
PANTHER	60S RIBOSOMAL PROTEIN L3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11363	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Ribosomal_L3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Rpl3	PhenoGen
PROSITE	RIBOSOMAL_L3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000016896	RatGTEx
	ENSRNOG00055028945	RatGTEx
	ENSRNOG00060031495	RatGTEx
	ENSRNOG00065033278	RatGTEx
Superfamily-SCOP	SSF50447	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0U1RRR9_RAT	UniProtKB/TrEMBL
	A0A8L2QVY8	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2R1Y6_RAT	UniProtKB/TrEMBL
	A6HSV3_RAT	UniProtKB/TrEMBL
	A6HSV4	ENTREZGENE, UniProtKB/TrEMBL
	P21531	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Rpl3	ribosomal protein L3			Symbol and Name status set to approved	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations