Advanced Search (OLGA)

Gene: Gjc3 (gap junction protein, gamma 3) Rattus norvegicus

Analyze

Symbol:

Gjc3

Name:

gap junction protein, gamma 3

RGD ID:

727930

Description:

Predicted to enable gap junction channel activity and identical protein binding activity. Predicted to be involved in cell-cell signaling. Predicted to act upstream of or within myelination and sensory perception of sound. Predicted to be located in myelin sheath. Predicted to be part of connexin complex. Orthologous to human GJC3 (gap junction protein gamma 3); INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

connexin 29; connexin p1; Cx29; Cxnp1; gap junction gamma-3 protein; gap junction membrane channel protein epsilon 1; Gje1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GJC3 (gap junction protein gamma 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Gjc3 (gap junction protein, gamma 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gjc3 (gap junction protein gamma 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GJC3 (gap junction protein gamma 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GJC3 (gap junction protein gamma 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gjc3 (gap junction protein gamma 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GJC3 (gap junction protein gamma 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103246762 (gap junction gamma-3 protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gjc3 (gap junction protein gamma 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Gjc3 (gap junction protein gamma 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	GJC3 (gap junction protein gamma 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	GJC3 (gap junction protein gamma 3)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gjc3 (gap junction protein, gamma 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gjc3 (gap junction protein, gamma 3)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	22,009,560 - 22,024,567 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	22,009,409 - 22,078,418 (-)	Ensembl				GRCr8
mRatBN7.2	12	16,899,846 - 16,912,309 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	16,896,813 - 16,964,246 (-)	Ensembl				mRatBN7.2
Rnor_6.0	12	19,166,074 - 19,177,701 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	19,166,239 - 19,167,015 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	21,225,286 - 21,236,284 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	17,460,857 - 17,487,768 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	18,838,972 - 18,850,217 (-)	NCBI		Celera
RGSC_v3.1	12	17,450,771 - 17,451,011 (-)	NCBI
Cytogenetic Map	12	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

sensorineural hearing loss (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

aflatoxin B1 (EXP,ISO)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

Cuprizon (EXP)

dichloroacetic acid (ISO)

epoxiconazole (ISO)

ethanol (ISO)

folic acid (ISO)

lead diacetate (EXP)

MeIQx (ISO)

okadaic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

rotenone (EXP,ISO)

silicon dioxide (ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

trichloroethene (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell communication (IEA)

myelination (ISO)

sensory perception of sound (ISO)

Cellular Component

connexin complex (IEA)

gap junction (IEA)

myelin sheath (ISO)

plasma membrane (IEA)

Molecular Function

identical protein binding (ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	NCBI rat LocusLink and RefSeq merged data October 15, 2003	NCBI rat LocusLink and RefSeq merged data October 15, 2003
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Connexin29 is highly expressed in cochlear Schwann cells, and it is required for the normal development and function of the auditory nerve of mice.	Tang W, etal., J Neurosci. 2006 Feb 15;26(7):1991-9.
7.	Expression patterns of connexin 29 (GJE1) in mouse and rat cochlea.	Yang JJ, etal., Biochem Biophys Res Commun. 2005 Dec 16;338(2):723-8. Epub 2005 Oct 11.

Additional References at PubMed

PMID:16194882	PMID:20578039	PMID:22871113

Genomics

Comparative Map Data

Gjc3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	22,009,560 - 22,024,567 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	22,009,409 - 22,078,418 (-)	Ensembl				GRCr8
mRatBN7.2	12	16,899,846 - 16,912,309 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	16,896,813 - 16,964,246 (-)	Ensembl				mRatBN7.2
Rnor_6.0	12	19,166,074 - 19,177,701 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	19,166,239 - 19,167,015 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	21,225,286 - 21,236,284 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	17,460,857 - 17,487,768 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	18,838,972 - 18,850,217 (-)	NCBI		Celera
RGSC_v3.1	12	17,450,771 - 17,451,011 (-)	NCBI
Cytogenetic Map	12	q11	NCBI

GJC3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	99,923,266 - 99,930,747 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	99,923,266 - 99,929,620 (-)	Ensembl			hg38	GRCh38
GRCh37	7	99,520,889 - 99,527,243 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	99,359,104 - 99,365,179 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	7	99,165,818 - 99,171,894	NCBI
Celera	7	94,255,435 - 94,261,786 (-)	NCBI		Celera
Cytogenetic Map	7	q22.1	NCBI
HuRef	7	94,156,573 - 94,162,925 (-)	NCBI		HuRef
CHM1_1	7	99,451,053 - 99,457,401 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	101,162,767 - 101,170,248 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	98,881,013 - 98,887,364 (-)	NCBI

Gjc3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	137,949,254 - 137,961,360 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	137,951,723 - 137,961,360 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	137,950,992 - 137,963,098 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	137,953,461 - 137,963,098 (-)	Ensembl			mm10	GRCm38
MGSCv37	5	138,395,037 - 138,404,187 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	138,183,597 - 138,192,747 (-)	NCBI		MGSCv36	mm8
Celera	5	134,939,770 - 134,948,822 (-)	NCBI		Celera
Cytogenetic Map	5	G2	NCBI
cM Map	5	76.91	NCBI

Gjc3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955573	944,440 - 951,440 (+)	NCBI	ChiLan1.0	ChiLan1.0

GJC3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	117,840,909 - 117,850,230 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	166,105,543 - 166,115,817 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	91,956,757 - 91,963,417 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	105,390,290 - 105,396,643 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	105,390,567 - 105,396,643 (-)	Ensembl			panPan2	panpan1.1

GJC3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	9,648,769 - 9,656,507 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	9,648,608 - 9,656,181 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	11,287,180 - 11,296,874 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	9,586,242 - 9,594,366 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	9,586,288 - 9,596,648 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	9,435,179 - 9,444,843 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	9,415,520 - 9,425,212 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	9,594,662 - 9,604,333 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gjc3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	133,962,465 - 133,963,816 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936543	71,138 - 74,065 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936543	73,253 - 74,065 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GJC3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	7,839,151 - 7,848,761 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	3	7,843,398 - 7,849,864 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	7,066,027 - 7,072,240 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103246762
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	28	13,153,447 - 13,160,951 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666070	3,108,416 - 3,114,830 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gjc3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624740	17,068,237 - 17,092,297 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Gjc3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	16	15,409,369 - 15,420,433 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Gjc3
81 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	118
Count of miRNA genes:	94
Interacting mature miRNAs:	99
Transcripts:	ENSRNOT00000001797
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312418	Kidm41	Kidney mass QTL 41	3.7	0.0001	kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	12	5921918	25247790	Rat
61443	Btemp2	Thermal response to stress QTL 2	3.3	0.000094	body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	12	20139028	26430640	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	11200494	52308831	Rat
2306789	Ean6	Experimental allergic neuritis QTL 6	4.9		nervous system integrity trait (VT:0010566)	experimental autoimmune neuritis severity score (CMO:0001528)	12	1	29775522	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	3489416	48489416	Rat
1331739	Hrtrt14	Heart rate QTL 14	3.56232		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	12	1	38687564	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	18473041	52308831	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200497	52308831	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	15264248	52308831	Rat
61331	Eau2	Experimental allergic uveoretinitis QTL 2		0.0005	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	12	1	33700600	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	11743528	52308831	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	1	38635130	Rat
6893681	Bw109	Body weight QTL 109	2.3	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	12	1	28133365	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	12233000	30490641	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	17464979	46784661	Rat
1300174	Bw15	Body weight QTL 15	2.93		body mass (VT:0001259)	body weight loss (CMO:0001399)	12	1	28606299	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	16187438	52308831	Rat
1331787	Rf41	Renal function QTL 41	2.998		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	12	1	33700556	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	16135029	52308831	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	51213550	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	11200494	52308831	Rat
61416	Pia4	Pristane induced arthritis QTL 4	8.4		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	12	18749469	36488809	Rat
7204484	Bp358	Blood pressure QTL 358		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	1	24849755	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	11200494	52308831	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	41361854	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	18749469	34312613	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	2747694	47747694	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	18473041	52308831	Rat
2303568	Bw88	Body weight QTL 88	3		body mass (VT:0001259)	body weight (CMO:0000012)	12	1	28606299	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	3087180	48087180	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7243862	Mcs30	Mammary carcinoma susceptibility QTL 30	8.62		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	12	5633306	50633306	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	16135029	52308831	Rat
2293086	Iddm30	Insulin dependent diabetes mellitus QTL 30	3.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	7901625	33938215	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
1331755	Bp219	Blood pressure QTL 219	3.041		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	33700556	Rat

Markers in Region

D12Got34

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	16,902,153 - 16,902,360 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	19,167,587 - 19,167,793	NCBI	Rnor6.0
Rnor_5.0	12	21,226,799 - 21,227,005	UniSTS	Rnor5.0
RGSC_v3.4	12	17,462,204 - 17,462,411	RGD	RGSC3.4
RGSC_v3.4	12	17,462,205 - 17,462,411	UniSTS	RGSC3.4
Celera	12	18,840,275 - 18,840,487	UniSTS
RGSC_v3.1	12	17,451,727 - 17,451,933	RGD
RH 3.4 Map	12	255.4	UniSTS
RH 3.4 Map	12	255.4	RGD
RH 2.0 Map	12	175.0	RGD
Cytogenetic Map	12	q11	UniSTS

BF397585

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	16,911,673 - 16,911,886 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	19,177,098 - 19,177,310	NCBI	Rnor6.0
Rnor_5.0	12	21,235,909 - 21,236,121	UniSTS	Rnor5.0
RGSC_v3.4	12	17,472,405 - 17,472,617	UniSTS	RGSC3.4
Celera	12	18,849,613 - 18,849,825	UniSTS
RH 3.4 Map	12	255.4	UniSTS
Cytogenetic Map	12	q11	UniSTS

RH141809

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	16,907,618 - 16,907,812 (+)	MAPPER	mRatBN7.2
mRatBN7.2	1	146,645,948 - 146,646,128 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	157,416,788 - 157,416,967	NCBI	Rnor6.0
Rnor_6.0	12	19,173,043 - 19,173,236	NCBI	Rnor6.0
Rnor_5.0	12	21,231,854 - 21,232,047	UniSTS	Rnor5.0
Rnor_5.0	1	163,660,936 - 163,661,115	UniSTS	Rnor5.0
RGSC_v3.4	1	149,423,690 - 149,423,869	UniSTS	RGSC3.4
RGSC_v3.4	12	17,468,350 - 17,468,543	UniSTS	RGSC3.4
Celera	12	18,845,556 - 18,845,749	UniSTS
Celera	1	144,825,489 - 144,825,668	UniSTS
Cytogenetic Map	1	q32	UniSTS
Cytogenetic Map	12	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	35	121	88	87	59	77	59	6	300	144	10	101	73	90	28	10	10

Sequence

Nucleotide Sequences


RefSeq Transcripts	XM_017604537	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_221997	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY233215	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LT990407	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001797 ⟹ ENSRNOP00000001797

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	22,014,435 - 22,077,058 (-)	Ensembl
mRatBN7.2 Ensembl	12	16,900,582 - 16,964,246 (-)	Ensembl
Rnor_6.0 Ensembl	12	19,166,239 - 19,167,015 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000100826 ⟹ ENSRNOP00000093508

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	22,009,561 - 22,056,763 (-)	Ensembl
mRatBN7.2 Ensembl	12	16,896,813 - 16,911,087 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000100945 ⟹ ENSRNOP00000077521

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	22,013,274 - 22,078,418 (-)	Ensembl
mRatBN7.2 Ensembl	12	16,899,594 - 16,930,896 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000101441 ⟹ ENSRNOP00000081831

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	22,013,322 - 22,070,760 (-)	Ensembl
mRatBN7.2 Ensembl	12	16,899,594 - 16,956,860 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104293 ⟹ ENSRNOP00000087790

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	22,013,273 - 22,078,418 (-)	Ensembl
mRatBN7.2 Ensembl	12	16,899,470 - 16,956,860 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000117008 ⟹ ENSRNOP00000078772

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	22,013,273 - 22,078,418 (-)	Ensembl
mRatBN7.2 Ensembl	12	16,899,816 - 16,923,117 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000137112 ⟹ ENSRNOP00000102230

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	22,009,409 - 22,025,660 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000144330 ⟹ ENSRNOP00000102340

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	22,013,395 - 22,022,439 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000148806 ⟹ ENSRNOP00000100140

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	22,013,274 - 22,078,418 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000166632 ⟹ ENSRNOP00000104386

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	22,009,421 - 22,025,606 (-)	Ensembl

RefSeq Acc Id:

XM_221997 ⟹ XP_221997

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	22,009,560 - 22,024,567 (-)	NCBI
mRatBN7.2	12	16,899,846 - 16,912,309 (-)	NCBI
Rnor_6.0	12	19,166,074 - 19,177,701 (-)	NCBI
Rnor_5.0	12	21,225,286 - 21,236,284 (-)	NCBI
RGSC_v3.4	12	17,460,857 - 17,487,768 (-)	RGD

Sequence:

show sequence

CTTTCTTTTTTTCTAATGAAAAGAATGGGGTTCTAAGAGATAGCAACCAAATATGACAGAATAA
AATAAGATAGAGCAAAAACCATCACATTGAGGTGGGACAAAGCAACCCAACAGAAGGAAAAGAG
CCCCAAGGGCAGGCAGGCTCAAGAATCAGAGACCCACTTGTTCACACTCTCAGGAATACTCCTA
CCAACACACAGGCACACTCTTATGTTAGTAAACTTATATTTCAGGGTACTTTGTTTTGAATGAG
TGAGTTTGTTAAGCACATAGCTTGCTATACTTTCATTTTTGAATGAGTTTATTGAGCACAAGGC
AGGGTAAAGGAGTAAATAAAAAGTGATTGGTTGACTGAGATGAATCTCATCATATTGGGGCTTA
CAAACAGCCAGCAGGAAATGACTAGGGAGAGACAGTCAGATGGAGTTTCCCACAGAGAAATTCC
AGGGCGGAGCAGGGTGTCCCCTCCAGTGAACCTTTTAAGTAAGACAACCCCACACAAAGAACTA
CAGGCAACTGGGTAAAACTGGGAGTGGGAGAGGTGGTCCTTCCCAGGAAAGAGTGCTCTAATTG
GATGTTTGATGCCAAATAGTCAACCCTGAAAACACAGATACAAATAGCTTTATATGGACTCAAT
AGATTACACTTGACAATCTATGTGTACACAAGCATGCAATAATAATTGATTAAAAAAGGCCATG
AATTTGAAGGAGATAAGGGAGGTGTATATGACACACTTGGGGGAGAGGAAAGAAGGGCAAATTG
TCATTAAAATGCTATCTCCAAAGGAAAAACTAAAAGAGGAAAAATAGATAACAAATAATAGACA
GAAGCATCCTCATCAAATTGGGTGCTCTCAAGATCCAACAGAAACTGACTGGGAAATTCAGAGC
AGTCATCTGGAGTTCTCCACTGAGCTTTCTGTCCTCGCCTGAGCTCCCCATGGGTGCACTGCAG
CCCTTCTCCCACTCTGGGACACACAATGTAGGACATAGCAGCAGCTTCTGCTGTATTTTCTCGC
AGCTCGTTTTCTTCTAGCTGTTTTCAAGAAGACAATGTTTTTACTCTTTGGCTGTTGGCTGTTT
CCCTTCCTCCGTGTTACAGAGTCTGGGAGGCAGCTCATCCCTAGGTCCTTAGAAGATCCTCTGA
GACAAACATACTTGGGTCTCAAGTGAGAGAGGTCAGTCCTACTTTTCAGTGAGCTCTCAGTGAG
CTCAATCATCCCAAGACAATTAACCAATAGAATGTACAGAATAAACCTTCACTTCTTTCAGATG
GTCTCAAAGCCTCCATTCACGTAGAGAATACATCCCGTGACCTTGACACCACAGTCACTCCCCA
GAGATCGTGACTTGAGGGCAGGGTCTCCTGGTCCTCCAGTTGGAATTCTTTTATGCTGCAGCGA
GCCTGCCAGGAATGAAAAGGAGAAGGCGAAAGAGTGGGTGGCTGCAGGAGGCAGGGCCATTGCC
AGATTCTAGACCCTGCAGGCTCCAGTGTGAGGATTCCTTTTGGCTCCTTTCCTCTGTGGTTGAT
GCTTCTGCTTGGAGTTGCCAGGCAAGTGCAGGATGTGCTGCAGTTTCCTGAGACAGCTATTGGC
TCGGGAGAGCCAGCACTCCACCCCGGTGGGGCGCTTCCTTCTTCCGGTGCTCGTGGGATTCCGT
CTCCTGATTCTGGTTTCCAGCGGACCTGGCGTTTTCGGCAATGATGAGAACGAATTCATGTGTC
ATTTAGGGCAGCCAGGATGTAAGACCATTTGTTATGATGTCTTCCGCCCTCTCTCTCCGTTGCG
CTTCTGGGCCTTCCAAGTCATCCTGATGGCTGTACCCAGCGCTATTTATGTGGCTTTCACTCTG
TATCATGTGATTGGATACTGGGAGGTACCAGGCAGGAACAAGGAGCAAGAGGCCCAGATTTGCA
AAGGGGGTCGTTGCAAGGATGTCTCAGGGGCTATGAGCCTCAAGCTTCTCTGGGCCTATGTGGC
ACACCTTGGGGTGCGGCTGGTCCTTGAGGGAGCAGCTCTAGGAGTTCAGTACCATCTATATGGC
TTCAAGATGCCCAGCACTTTTATATGTCGTGAGGATCCTTGTATTGGCAGCACAACCTGTTTCC
AGTCTCACCCTTCTGAGAAGACCATCCTCCTCAACACCATGTTTGGGATCAGCGGGGCCTGTCT
CTTATTTATTTTCTTGGAGCTTGTGCTTTTGGGTTTAGGGAGGGTTTGGAAGACGTACAGGCAC
AAACTTCCCCTCTTTAAGAACTTGTCAACCTCAGAGCGCTCTGTAAGACACAAGGACACAACCG
ATGACTTGTCAGTGGTGGAGACAAAAGAGCCATTTTGAGAAGCAGGTGAGAACCCTACTGACAG
TCATCTGTCCCTGCCTCTGATGTCTCTGTGTTGGCAGTCCCCACCCTTGTCCTTTGGGGTGAAC
AGCTCCCCACGTTATAATGTGTAGATAATCGATCTCCAAGTAGATACATTCTAAAAATTATTTA
CTTTTTACTTT

hide sequence

Protein Sequences


Protein RefSeqs	XP_221997	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAP04732	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001797.4
	ENSRNOP00000077521.1
	ENSRNOP00000078772.2
	ENSRNOP00000081831.1
	ENSRNOP00000087790.1
	ENSRNOP00000093508.1
	ENSRNOP00000100140.1
	ENSRNOP00000102230
	ENSRNOP00000102230.1
	ENSRNOP00000102340.1
	ENSRNOP00000104386.1
GenBank Protein	VZP20207	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

XP_221997 ⟸ XM_221997

- UniProtKB:

A0A654IDW2 (UniProtKB/TrEMBL), F1LPT0 (UniProtKB/TrEMBL), A6KSR9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MCCSFLRQLLARESQHSTPVGRFLLPVLVGFRLLILVSSGPGVFGNDENEFMCHLGQPGCKTIC
YDVFRPLSPLRFWAFQVILMAVPSAIYVAFTLYHVIGYWEVPGRNKEQEAQICKGGRCKDVSGA
MSLKLLWAYVAHLGVRLVLEGAALGVQYHLYGFKMPSTFICREDPCIGSTTCFQSHPSEKTILL
NTMFGISGACLLFIFLELVLLGLGRVWKTYRHKLPLFKNLSTSERSVRHKDTTDDLSVVETKEP
F

hide sequence

Ensembl Acc Id:

ENSRNOP00000001797 ⟸ ENSRNOT00000001797

Ensembl Acc Id:

ENSRNOP00000093508 ⟸ ENSRNOT00000100826

Ensembl Acc Id:

ENSRNOP00000077521 ⟸ ENSRNOT00000100945

Ensembl Acc Id:

ENSRNOP00000078772 ⟸ ENSRNOT00000117008

Ensembl Acc Id:

ENSRNOP00000081831 ⟸ ENSRNOT00000101441

Ensembl Acc Id:

ENSRNOP00000087790 ⟸ ENSRNOT00000104293

Ensembl Acc Id:

ENSRNOP00000102340 ⟸ ENSRNOT00000144330

Ensembl Acc Id:

ENSRNOP00000102230 ⟸ ENSRNOT00000137112

Ensembl Acc Id:

ENSRNOP00000100140 ⟸ ENSRNOT00000148806

Ensembl Acc Id:

ENSRNOP00000104386 ⟸ ENSRNOT00000166632

Protein Domains

Connexin N-terminal Gap junction protein cysteine-rich

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1LPT0-F1-model_v2	AlphaFold	F1LPT0	1-258	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:727930	AgrOrtholog
BioCyc Gene	G2FUF-19831	BioCyc
Ensembl Genes	ENSRNOG00000001329	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000001797.6	UniProtKB/TrEMBL
	ENSRNOT00000100826.2	UniProtKB/TrEMBL
	ENSRNOT00000100945.2	UniProtKB/TrEMBL
	ENSRNOT00000101441.2	UniProtKB/TrEMBL
	ENSRNOT00000104293.2	UniProtKB/TrEMBL
	ENSRNOT00000117008.2	UniProtKB/TrEMBL
	ENSRNOT00000137112	ENTREZGENE
	ENSRNOT00000137112.1	UniProtKB/TrEMBL
	ENSRNOT00000144330.1	UniProtKB/TrEMBL
	ENSRNOT00000148806.1	UniProtKB/TrEMBL
	ENSRNOT00000166632.1	UniProtKB/TrEMBL
Gene3D-CATH	1.20.1440.80	UniProtKB/TrEMBL
InterPro	Connexin	UniProtKB/TrEMBL
	Connexin_CCC	UniProtKB/TrEMBL
	Connexin_CS	UniProtKB/TrEMBL
	Connexin_N	UniProtKB/TrEMBL
	Connexin_N_sf	UniProtKB/TrEMBL
KEGG Report	rno:288529	UniProtKB/TrEMBL
NCBI Gene	288529	ENTREZGENE
PANTHER	Connexin	UniProtKB/TrEMBL
	GAP JUNCTION GAMMA-3 PROTEIN	UniProtKB/TrEMBL
Pfam	Connexin	UniProtKB/TrEMBL
PhenoGen	Gjc3	PhenoGen
PRINTS	CONNEXIN	UniProtKB/TrEMBL
PROSITE	CONNEXINS_1	UniProtKB/TrEMBL
	CONNEXINS_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000001329	RatGTEx
SMART	CNX	UniProtKB/TrEMBL
	Connexin_CCC	UniProtKB/TrEMBL
UniProt	A0A654IDW2	ENTREZGENE
	A6KSR9	ENTREZGENE, UniProtKB/TrEMBL
	F1LPT0	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	A0A654IDW2	UniProtKB/TrEMBL
	A0A8I5ZPD7	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-10-30	Gjc3	gap junction protein, gamma 3	Gje1	gap junction membrane channel protein epsilon 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Gje1	gap junction membrane channel protein epsilon 1			Symbol and Name status set to approved	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message