Symbol:
Nap1l1
Name:
nucleosome assembly protein 1-like 1
RGD ID:
71094
Description:
Enables kinase binding activity. Involved in Schwann cell proliferation and cellular response to peptide hormone stimulus. Predicted to be located in cytoplasm. Predicted to be active in chromatin and nucleus. Human ortholog(s) of this gene implicated in pancreatic cancer. Orthologous to human NAP1L1 (nucleosome assembly protein 1 like 1); PARTICIPATES IN histone modification pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
MGC72278; NAP-1-related protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 48,819,464 - 48,844,108 (+) NCBI GRCr8 mRatBN7.2 7 46,933,278 - 46,957,853 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 46,933,356 - 46,956,593 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 48,833,036 - 48,856,337 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 51,036,091 - 51,059,392 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 50,813,953 - 50,837,254 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 54,213,305 - 54,237,880 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 54,213,319 - 54,236,625 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 54,238,038 - 54,262,614 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 50,506,870 - 50,530,177 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 50,527,406 - 50,550,142 (+) NCBI Celera 7 43,730,965 - 43,754,274 (+) NCBI Celera Cytogenetic Map 7 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nap1l1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of NAP1L1 mRNA] CTD PMID:31150632 Nap1l1 Rat 1,2-dimethylhydrazine multiple interactions ISO Nap1l1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of NAP1L1 mRNA CTD PMID:22206623 Nap1l1 Rat 17alpha-ethynylestradiol increases expression ISO Nap1l1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of NAP1L1 mRNA CTD PMID:17942748 Nap1l1 Rat 17alpha-ethynylestradiol multiple interactions ISO Nap1l1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NAP1L1 mRNA CTD PMID:17942748 Nap1l1 Rat 17beta-estradiol increases expression ISO Nap1l1 (Mus musculus) 6480464 Estradiol results in increased expression of NAP1L1 mRNA CTD PMID:39298647 Nap1l1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Nap1l1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in decreased expression of NAP1L1 mRNA and [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NAP1L1 mRNA CTD PMID:16214954 and PMID:17942748 Nap1l1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NAP1L1 mRNA CTD PMID:34747641 Nap1l1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Nap1l1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of NAP1L1 mRNA CTD PMID:21570461 Nap1l1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of NAP1L1 mRNA CTD PMID:22298810 Nap1l1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Nap1l1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of NAP1L1 mRNA CTD PMID:19770486 Nap1l1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of NAP1L1 mRNA CTD PMID:21346803 Nap1l1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of NAP1L1 mRNA CTD PMID:21346803 Nap1l1 Rat 2-amino-14,16-dimethyloctadecan-3-ol decreases expression ISO NAP1L1 (Homo sapiens) 6480464 2-amino-14 and 16-dimethyloctadecan-3-ol results in decreased expression of NAP1L1 protein CTD PMID:32044396 Nap1l1 Rat 2-bromohexadecanoic acid multiple interactions ISO NAP1L1 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of NAP1L1 protein] CTD PMID:38195004 Nap1l1 Rat 2-methylcholine affects expression ISO NAP1L1 (Homo sapiens) 6480464 beta-methylcholine affects the expression of NAP1L1 mRNA CTD PMID:21179406 Nap1l1 Rat 2-nitrofluorene increases expression EXP 6480464 2-nitrofluorene results in increased expression of NAP1L1 mRNA CTD PMID:15890375 Nap1l1 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO NAP1L1 (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of NAP1L1 protein CTD PMID:31675489 Nap1l1 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Nap1l1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of NAP1L1 mRNA CTD PMID:26251327 Nap1l1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO NAP1L1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of NAP1L1 mRNA CTD PMID:28628672 Nap1l1 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of NAP1L1 mRNA CTD PMID:19162173 Nap1l1 Rat 4,4'-sulfonyldiphenol increases expression ISO Nap1l1 (Mus musculus) 6480464 bisphenol S results in increased expression of NAP1L1 mRNA CTD PMID:39298647 Nap1l1 Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one increases expression EXP 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased expression of NAP1L1 mRNA CTD PMID:15890375 Nap1l1 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of NAP1L1 mRNA CTD PMID:21346803 Nap1l1 Rat 4-hydroxyphenyl retinamide decreases expression ISO Nap1l1 (Mus musculus) 6480464 Fenretinide results in decreased expression of NAP1L1 mRNA CTD PMID:28973697 Nap1l1 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of NAP1L1 mRNA CTD PMID:19483382 Nap1l1 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of NAP1L1 mRNA CTD PMID:19483382 Nap1l1 Rat actinomycin D multiple interactions ISO NAP1L1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of NAP1L1 protein CTD PMID:38460933 Nap1l1 Rat aflatoxin B1 decreases expression ISO Nap1l1 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of NAP1L1 mRNA CTD PMID:19770486 Nap1l1 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of NAP1L1 mRNA CTD PMID:15890375 Nap1l1 Rat aflatoxin M1 decreases expression ISO NAP1L1 (Homo sapiens) 6480464 Aflatoxin M1 results in decreased expression of NAP1L1 mRNA CTD PMID:30928695 Nap1l1 Rat all-trans-retinoic acid decreases expression ISO NAP1L1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of NAP1L1 mRNA CTD PMID:15498508 and PMID:33167477 Nap1l1 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of NAP1L1 mRNA CTD PMID:19483382 Nap1l1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of NAP1L1 mRNA CTD PMID:16483693 Nap1l1 Rat aristolochic acid A decreases expression ISO NAP1L1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of NAP1L1 mRNA CTD PMID:33212167 Nap1l1 Rat Aroclor 1254 decreases expression ISO Nap1l1 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of NAP1L1 mRNA CTD PMID:23650126 Nap1l1 Rat arsenite(3-) multiple interactions ISO NAP1L1 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to NAP1L1 protein] CTD PMID:32406909 Nap1l1 Rat arsenous acid increases expression ISO NAP1L1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of NAP1L1 mRNA CTD PMID:20458559 Nap1l1 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of NAP1L1 mRNA CTD PMID:19483382 Nap1l1 Rat benzo[a]pyrene decreases expression ISO Nap1l1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of NAP1L1 mRNA CTD PMID:19770486 Nap1l1 Rat benzo[a]pyrene increases expression ISO Nap1l1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of NAP1L1 mRNA CTD PMID:22228805 Nap1l1 Rat beta-lapachone decreases expression ISO NAP1L1 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of NAP1L1 mRNA CTD PMID:38218311 Nap1l1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Nap1l1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of NAP1L1 mRNA CTD PMID:33754040 Nap1l1 Rat bisphenol A decreases expression ISO Nap1l1 (Mus musculus) 6480464 bisphenol A results in decreased expression of NAP1L1 mRNA CTD PMID:23798566 Nap1l1 Rat bisphenol A decreases expression ISO NAP1L1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of NAP1L1 protein CTD PMID:34186270 Nap1l1 Rat bisphenol A multiple interactions ISO NAP1L1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of NAP1L1 mRNA CTD PMID:28628672 Nap1l1 Rat bisphenol A decreases methylation ISO Nap1l1 (Mus musculus) 6480464 bisphenol A results in decreased methylation of NAP1L1 promoter CTD PMID:27312807 Nap1l1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NAP1L1 mRNA CTD PMID:25181051 Nap1l1 Rat bisphenol AF increases expression ISO NAP1L1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of NAP1L1 protein CTD PMID:34186270 Nap1l1 Rat bisphenol F increases expression ISO Nap1l1 (Mus musculus) 6480464 bisphenol F results in increased expression of NAP1L1 mRNA CTD PMID:38685157 Nap1l1 Rat bisphenol F increases expression ISO NAP1L1 (Homo sapiens) 6480464 bisphenol F results in increased expression of NAP1L1 protein CTD PMID:34186270 Nap1l1 Rat bleomycin A2 decreases expression ISO Nap1l1 (Mus musculus) 6480464 Bleomycin results in decreased expression of NAP1L1 protein CTD PMID:29733421 Nap1l1 Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of NAP1L1 protein CTD PMID:28903499 Nap1l1 Rat butyric acid decreases expression ISO NAP1L1 (Homo sapiens) 6480464 Butyric Acid results in decreased expression of NAP1L1 protein CTD PMID:34581912 Nap1l1 Rat cadmium atom multiple interactions ISO NAP1L1 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of NAP1L1 protein] more ... CTD PMID:35301059 and PMID:38195004 Nap1l1 Rat cadmium dichloride multiple interactions ISO NAP1L1 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of NAP1L1 protein] more ... CTD PMID:35301059 and PMID:38195004 Nap1l1 Rat caffeine decreases phosphorylation ISO NAP1L1 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of NAP1L1 protein CTD PMID:35688186 Nap1l1 Rat calcitriol decreases expression ISO NAP1L1 (Homo sapiens) 6480464 Calcitriol results in decreased expression of NAP1L1 mRNA CTD PMID:12798352 Nap1l1 Rat carbon nanotube decreases expression ISO Nap1l1 (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of NAP1L1 mRNA CTD PMID:25554681 Nap1l1 Rat choline multiple interactions ISO Nap1l1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of NAP1L1 gene CTD PMID:20938992 Nap1l1 Rat chromium(6+) affects expression ISO Nap1l1 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of NAP1L1 mRNA CTD PMID:28472532 Nap1l1 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of NAP1L1 mRNA CTD PMID:19483382 Nap1l1 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of NAP1L1 mRNA CTD PMID:17602206 Nap1l1 Rat cobalt dichloride increases expression ISO NAP1L1 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of NAP1L1 mRNA CTD PMID:19376846 Nap1l1 Rat copper(II) sulfate decreases expression ISO NAP1L1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of NAP1L1 mRNA CTD PMID:19549813 Nap1l1 Rat coumarin affects phosphorylation ISO NAP1L1 (Homo sapiens) 6480464 coumarin affects the phosphorylation of NAP1L1 protein CTD PMID:35688186 Nap1l1 Rat cyclosporin A increases expression ISO NAP1L1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of NAP1L1 mRNA CTD PMID:20106945 Nap1l1 Rat cyclosporin A decreases expression ISO NAP1L1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of NAP1L1 mRNA CTD PMID:27989131 Nap1l1 Rat cyclosporin A affects expression ISO Nap1l1 (Mus musculus) 6480464 Cyclosporine affects the expression of NAP1L1 mRNA CTD PMID:19770486 Nap1l1 Rat dexamethasone multiple interactions ISO NAP1L1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of NAP1L1 mRNA CTD PMID:28628672 Nap1l1 Rat diarsenic trioxide increases expression ISO NAP1L1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of NAP1L1 mRNA CTD PMID:20458559 Nap1l1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of NAP1L1 mRNA CTD PMID:21266533 Nap1l1 Rat dicrotophos decreases expression ISO NAP1L1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of NAP1L1 mRNA CTD PMID:28302478 Nap1l1 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of NAP1L1 mRNA CTD PMID:15890375 Nap1l1 Rat disodium selenite increases expression ISO NAP1L1 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of NAP1L1 mRNA CTD PMID:18175754 Nap1l1 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of NAP1L1 mRNA CTD PMID:21551480 Nap1l1 Rat diuron decreases expression ISO NAP1L1 (Homo sapiens) 6480464 Diuron results in decreased expression of NAP1L1 mRNA CTD PMID:35967413 Nap1l1 Rat doxorubicin affects expression ISO NAP1L1 (Homo sapiens) 6480464 Doxorubicin affects the expression of NAP1L1 protein CTD PMID:29385562 Nap1l1 Rat doxorubicin increases expression ISO NAP1L1 (Homo sapiens) 6480464 Doxorubicin results in increased expression of NAP1L1 mRNA CTD PMID:29803840 Nap1l1 Rat enzyme inhibitor multiple interactions ISO NAP1L1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of NAP1L1 protein CTD PMID:23301498 Nap1l1 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of NAP1L1 protein CTD PMID:24646710 Nap1l1 Rat ethanol affects splicing ISO Nap1l1 (Mus musculus) 6480464 Ethanol affects the splicing of NAP1L1 mRNA CTD PMID:30319688 Nap1l1 Rat ethyl methanesulfonate decreases expression ISO NAP1L1 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of NAP1L1 mRNA CTD PMID:23649840 Nap1l1 Rat etoposide affects response to substance ISO NAP1L1 (Homo sapiens) 6480464 NAP1L1 protein affects the susceptibility to Etoposide CTD PMID:16217747 Nap1l1 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of NAP1L1 mRNA CTD PMID:24136188 Nap1l1 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of NAP1L1 mRNA CTD PMID:23962444 Nap1l1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of NAP1L1 mRNA CTD PMID:24136188 Nap1l1 Rat folic acid multiple interactions ISO Nap1l1 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Nap1l1 Rat formaldehyde decreases expression ISO NAP1L1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of NAP1L1 mRNA CTD PMID:23649840 Nap1l1 Rat FR900359 increases phosphorylation ISO NAP1L1 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of NAP1L1 protein CTD PMID:37730182 Nap1l1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of NAP1L1 mRNA CTD PMID:22061828 Nap1l1 Rat hydralazine multiple interactions ISO NAP1L1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of NAP1L1 mRNA CTD PMID:17183730 Nap1l1 Rat hydrogen peroxide affects expression ISO NAP1L1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of NAP1L1 mRNA CTD PMID:21179406 Nap1l1 Rat hydrogen peroxide decreases expression ISO NAP1L1 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of NAP1L1 protein CTD PMID:34581912 Nap1l1 Rat indometacin multiple interactions ISO NAP1L1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of NAP1L1 mRNA CTD PMID:28628672 Nap1l1 Rat ivermectin decreases expression ISO NAP1L1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of NAP1L1 protein CTD PMID:32959892 Nap1l1 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of NAP1L1 mRNA CTD PMID:19483382 Nap1l1 Rat L-methionine multiple interactions ISO Nap1l1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of NAP1L1 gene CTD PMID:20938992 Nap1l1 Rat mercury atom increases expression ISO NAP1L1 (Homo sapiens) 6480464 Mercury results in increased expression of NAP1L1 mRNA CTD PMID:16823088 Nap1l1 Rat mercury(0) increases expression ISO NAP1L1 (Homo sapiens) 6480464 Mercury results in increased expression of NAP1L1 mRNA CTD PMID:16823088 Nap1l1 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of NAP1L1 mRNA CTD PMID:15890375 Nap1l1 Rat methyl methanesulfonate decreases expression ISO NAP1L1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of NAP1L1 mRNA CTD PMID:23649840 Nap1l1 Rat methylmercury chloride decreases expression ISO NAP1L1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of NAP1L1 mRNA CTD PMID:28001369 Nap1l1 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of NAP1L1 gene CTD PMID:33148267 Nap1l1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of NAP1L1 mRNA and [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of NAP1L1 mRNA CTD PMID:17602206 and PMID:28943392 Nap1l1 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of NAP1L1 mRNA CTD PMID:15890375 Nap1l1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of NAP1L1 mRNA CTD PMID:24136188 Nap1l1 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of NAP1L1 mRNA CTD PMID:24136188 Nap1l1 Rat nitrates multiple interactions ISO Nap1l1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of NAP1L1 mRNA CTD PMID:35964746 Nap1l1 Rat Nutlin-3 multiple interactions ISO NAP1L1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of NAP1L1 protein CTD PMID:38460933 Nap1l1 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of NAP1L1 mRNA CTD PMID:19483382 Nap1l1 Rat paracetamol affects expression ISO Nap1l1 (Mus musculus) 6480464 Acetaminophen affects the expression of NAP1L1 mRNA CTD PMID:17562736 Nap1l1 Rat paracetamol increases expression ISO NAP1L1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of NAP1L1 mRNA CTD PMID:22230336 Nap1l1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of NAP1L1 mRNA CTD PMID:17202762 and PMID:32479839 Nap1l1 Rat pentachlorophenol increases expression ISO Nap1l1 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of NAP1L1 mRNA CTD PMID:23892564 Nap1l1 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of NAP1L1 mRNA CTD PMID:19162173 Nap1l1 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of NAP1L1 gene CTD PMID:33148267 Nap1l1 Rat phenobarbital affects expression ISO NAP1L1 (Homo sapiens) 6480464 Phenobarbital affects the expression of NAP1L1 mRNA CTD PMID:19159669 Nap1l1 Rat piperonyl butoxide increases expression EXP 6480464 Piperonyl Butoxide results in increased expression of NAP1L1 mRNA CTD PMID:15890375 and PMID:22484513 Nap1l1 Rat pirinixic acid decreases expression ISO Nap1l1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of NAP1L1 mRNA CTD PMID:17426115 Nap1l1 Rat pirinixic acid increases expression ISO Nap1l1 (Mus musculus) 6480464 pirinixic acid results in increased expression of NAP1L1 mRNA CTD PMID:17950772 more ... Nap1l1 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of NAP1L1 mRNA CTD PMID:15890375 more ... Nap1l1 Rat pirinixic acid multiple interactions ISO Nap1l1 (Mus musculus) 6480464 PPARA protein promotes the reaction [pirinixic acid results in increased expression of NAP1L1 mRNA] CTD PMID:17950772 and PMID:20059764 Nap1l1 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of NAP1L1 mRNA CTD PMID:19483382 Nap1l1 Rat piroxicam increases expression ISO NAP1L1 (Homo sapiens) 6480464 Piroxicam results in increased expression of NAP1L1 mRNA CTD PMID:21858171 Nap1l1 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of NAP1L1 mRNA CTD PMID:19162173 Nap1l1 Rat pyrogallol increases expression ISO Nap1l1 (Mus musculus) 6480464 Pyrogallol results in increased expression of NAP1L1 mRNA CTD PMID:20362636 Nap1l1 Rat rimonabant multiple interactions ISO Nap1l1 (Mus musculus) 6480464 Rimonabant inhibits the reaction [Dietary Fats results in increased expression of NAP1L1 mRNA] CTD PMID:19030233 Nap1l1 Rat SB 431542 multiple interactions ISO NAP1L1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of NAP1L1 protein CTD PMID:37664457 Nap1l1 Rat sevoflurane decreases expression ISO Nap1l1 (Mus musculus) 6480464 Sevoflurane results in decreased expression of NAP1L1 protein CTD PMID:35249202 Nap1l1 Rat silicon dioxide decreases expression ISO Nap1l1 (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of NAP1L1 mRNA CTD PMID:19073995 Nap1l1 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of NAP1L1 mRNA CTD PMID:19072884 Nap1l1 Rat sodium arsenite decreases expression ISO NAP1L1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of NAP1L1 protein CTD PMID:30528433 Nap1l1 Rat sodium fluoride decreases expression ISO Nap1l1 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of NAP1L1 mRNA CTD PMID:27862939 Nap1l1 Rat sulindac decreases expression ISO NAP1L1 (Homo sapiens) 6480464 Sulindac results in decreased expression of NAP1L1 mRNA CTD PMID:11507085 Nap1l1 Rat sunitinib increases expression ISO NAP1L1 (Homo sapiens) 6480464 Sunitinib results in increased expression of NAP1L1 mRNA CTD PMID:31533062 Nap1l1 Rat tamibarotene decreases expression ISO NAP1L1 (Homo sapiens) 6480464 tamibarotene results in decreased expression of NAP1L1 mRNA CTD PMID:15498508 Nap1l1 Rat tert-butyl hydroperoxide decreases expression ISO NAP1L1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of NAP1L1 mRNA CTD PMID:15336504 Nap1l1 Rat tetrachloromethane increases expression ISO Nap1l1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of NAP1L1 mRNA CTD PMID:27339419 and PMID:31919559 Nap1l1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of NAP1L1 mRNA] CTD PMID:31150632 Nap1l1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of NAP1L1 mRNA CTD PMID:31150632 Nap1l1 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of NAP1L1 mRNA CTD PMID:19483382 Nap1l1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of NAP1L1 mRNA CTD PMID:34492290 Nap1l1 Rat thioacetamide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of NAP1L1 mRNA CTD PMID:28943392 Nap1l1 Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of NAP1L1 mRNA CTD PMID:30589522 Nap1l1 Rat triphenyl phosphate affects expression ISO NAP1L1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of NAP1L1 mRNA CTD PMID:37042841 Nap1l1 Rat uranium atom affects expression ISO NAP1L1 (Homo sapiens) 6480464 Uranium affects the expression of NAP1L1 mRNA CTD PMID:15672453 Nap1l1 Rat ursodeoxycholic acid affects expression ISO NAP1L1 (Homo sapiens) 6480464 Ursodeoxycholic Acid affects the expression of NAP1L1 mRNA CTD PMID:18422935 Nap1l1 Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of NAP1L1 mRNA CTD PMID:24136188 Nap1l1 Rat valproic acid affects expression ISO Nap1l1 (Mus musculus) 6480464 Valproic Acid affects the expression of NAP1L1 mRNA CTD PMID:17292431 Nap1l1 Rat valproic acid multiple interactions ISO NAP1L1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of NAP1L1 mRNA CTD PMID:17183730 Nap1l1 Rat valproic acid decreases expression ISO Nap1l1 (Mus musculus) 6480464 Valproic Acid results in decreased expression of NAP1L1 mRNA CTD PMID:19136453 Nap1l1 Rat valproic acid affects expression ISO NAP1L1 (Homo sapiens) 6480464 Valproic Acid affects the expression of NAP1L1 mRNA CTD PMID:25979313 Nap1l1 Rat valproic acid decreases expression ISO NAP1L1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of NAP1L1 mRNA CTD PMID:23179753 more ...
(+)-schisandrin B (EXP) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-amino-14,16-dimethyloctadecan-3-ol (ISO) 2-bromohexadecanoic acid (ISO) 2-methylcholine (ISO) 2-nitrofluorene (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP) 4-amino-2,6-dinitrotoluene (EXP) 4-hydroxyphenyl retinamide (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) actinomycin D (ISO) aflatoxin B1 (EXP,ISO) aflatoxin M1 (ISO) all-trans-retinoic acid (ISO) amiodarone (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzbromarone (EXP) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) bleomycin A2 (ISO) Brodifacoum (EXP) butyric acid (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) calcitriol (ISO) carbon nanotube (ISO) choline (ISO) chromium(6+) (ISO) clofibrate (EXP) clofibric acid (EXP) cobalt dichloride (ISO) copper(II) sulfate (ISO) coumarin (ISO) cyclosporin A (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) dibutyl phthalate (EXP) dicrotophos (ISO) diethylstilbestrol (EXP) disodium selenite (ISO) diuron (EXP,ISO) doxorubicin (ISO) enzyme inhibitor (ISO) ethanol (EXP,ISO) ethyl methanesulfonate (ISO) etoposide (ISO) finasteride (EXP) fipronil (EXP) flutamide (EXP) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) gentamycin (EXP) hydralazine (ISO) hydrogen peroxide (ISO) indometacin (ISO) ivermectin (ISO) L-ethionine (EXP) L-methionine (ISO) mercury atom (ISO) mercury(0) (ISO) methapyrilene (EXP) methyl methanesulfonate (ISO) methylmercury chloride (ISO) N,N-diethyl-m-toluamide (EXP) N-nitrosodiethylamine (EXP) N-nitrosodimethylamine (EXP) nefazodone (EXP) nimesulide (EXP) nitrates (ISO) Nutlin-3 (ISO) omeprazole (EXP) paracetamol (EXP,ISO) pentachlorophenol (ISO) perfluorooctanoic acid (EXP) permethrin (EXP) phenobarbital (ISO) piperonyl butoxide (EXP) pirinixic acid (EXP,ISO) piroxicam (ISO) pregnenolone 16alpha-carbonitrile (EXP) pyrogallol (ISO) rimonabant (ISO) SB 431542 (ISO) sevoflurane (ISO) silicon dioxide (ISO) sodium arsenite (EXP,ISO) sodium fluoride (ISO) sulindac (ISO) sunitinib (ISO) tamibarotene (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) triphenyl phosphate (EXP,ISO) uranium atom (ISO) ursodeoxycholic acid (ISO) valdecoxib (EXP) valproic acid (ISO)
1.
Histone chaperones in nucleosome assembly and human disease.
Burgess RJ and Zhang Z, Nat Struct Mol Biol. 2013 Jan;20(1):14-22. doi: 10.1038/nsmb.2461.
2.
Rat NAP1: cDNA cloning and upregulation by Mpl ligand.
Cataldo LM, etal., Gene. 1999 Jan 21;226(2):355-64.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Comparison in the biological characteristics between primary cultured sensory and motor Schwann cells.
He Q, etal., Neurosci Lett. 2012 Jul 11;521(1):57-61. doi: 10.1016/j.neulet.2012.05.059. Epub 2012 May 30.
6.
The role of genetic markers--NAP1L1, MAGE-D2, and MTA1--in defining small-intestinal carcinoid neoplasia.
Kidd M, etal., Ann Surg Oncol. 2006 Feb;13(2):253-62. Epub 2006 Jan 20.
7.
Characterisation of tumour-associated antigens in colon cancer.
Line A, etal., Cancer Immunol Immunother. 2002 Nov;51(10):574-82. Epub 2002 Sep 19.
8.
Genetic differentiation of appendiceal tumor malignancy: a guide for the perplexed.
Modlin IM, etal., Ann Surg. 2006 Jul;244(1):52-60.
9.
Transcriptional profiling in hepatoblastomas using high-density oligonucleotide DNA array.
Nagata T, etal., Cancer Genet Cytogenet. 2003 Sep;145(2):152-60.
10.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.
GOA pipeline
RGD automated data pipeline
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
A mechanistic role for the chromatin modulator, NAP1L1, in pancreatic neuroendocrine neoplasm proliferation and metastases.
Schimmack S, etal., Epigenetics Chromatin. 2014 Jul 21;7:15. doi: 10.1186/1756-8935-7-15. eCollection 2014.
15.
Molecular characterization of hNRP, a cDNA encoding a human nucleosome-assembly-protein-I-related gene product involved in the induction of cell proliferation.
Simon HU, etal., Biochem J 1994 Jan 15;297 ( Pt 2):389-97.
16.
Cellular expression and localization of DGKzeta-interacting NAP1-like proteins in the brain and functional implications under hypoxic stress.
Takahashi N, etal., Histochem Cell Biol. 2014 Nov;142(5):461-71. doi: 10.1007/s00418-014-1226-x. Epub 2014 Jun 4.
Nap1l1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 48,819,464 - 48,844,108 (+) NCBI GRCr8 mRatBN7.2 7 46,933,278 - 46,957,853 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 46,933,356 - 46,956,593 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 48,833,036 - 48,856,337 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 51,036,091 - 51,059,392 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 50,813,953 - 50,837,254 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 54,213,305 - 54,237,880 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 54,213,319 - 54,236,625 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 54,238,038 - 54,262,614 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 50,506,870 - 50,530,177 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 50,527,406 - 50,550,142 (+) NCBI Celera 7 43,730,965 - 43,754,274 (+) NCBI Celera Cytogenetic Map 7 q22 NCBI
NAP1L1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 76,036,585 - 76,084,685 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 76,036,585 - 76,084,735 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 76,430,365 - 76,478,465 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 74,726,221 - 74,764,717 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 74,726,224 - 74,764,717 NCBI Celera 12 76,105,836 - 76,145,881 (-) NCBI Celera Cytogenetic Map 12 q21.2 NCBI HuRef 12 73,488,713 - 73,528,719 (-) NCBI HuRef CHM1_1 12 76,404,610 - 76,444,687 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 76,011,669 - 76,059,726 (-) NCBI T2T-CHM13v2.0
Nap1l1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 111,308,754 - 111,334,011 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 111,309,084 - 111,334,011 (+) Ensembl GRCm39 Ensembl GRCm38 10 111,472,882 - 111,498,150 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 111,473,223 - 111,498,150 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 110,910,248 - 110,935,206 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 110,884,727 - 110,902,252 (+) NCBI MGSCv36 mm8 Celera 10 113,416,423 - 113,441,366 (+) NCBI Celera Cytogenetic Map 10 D1 NCBI cM Map 10 58.67 NCBI
Nap1l1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955405 15,330,328 - 15,365,208 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955405 15,332,696 - 15,365,181 (-) NCBI ChiLan1.0 ChiLan1.0
NAP1L1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 84,067,377 - 84,105,885 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 84,063,769 - 84,102,199 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 73,549,887 - 73,589,621 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 76,402,906 - 76,441,815 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 76,402,906 - 76,441,815 (-) Ensembl panpan1.1 panPan2
NAP1L1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 19,141,803 - 19,175,576 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 19,143,284 - 19,175,581 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 19,624,067 - 19,659,864 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 19,478,079 - 19,513,939 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 19,477,927 - 19,514,525 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 19,080,341 - 19,116,126 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 19,136,918 - 19,172,670 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 19,266,054 - 19,301,904 (-) NCBI UU_Cfam_GSD_1.0
Nap1l1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 41,277,724 - 41,313,258 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936568 4,419,652 - 4,440,608 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936568 4,416,225 - 4,440,566 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NAP1L1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 39,328,052 - 39,363,711 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 39,329,628 - 39,363,699 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 42,892,559 - 42,926,668 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NAP1L1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 71,639,965 - 71,679,131 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 71,522,837 - 71,678,825 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 173,870,263 - 173,909,998 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nap1l1
.
Predicted Target Of
Count of predictions: 90 Count of miRNA genes: 70 Interacting mature miRNAs: 85 Transcripts: ENSRNOT00000005286 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1354644 Spl4 Serum phospholipid level QTL 4 4.9 blood phospholipid amount (VT:0006084) blood phospholipid level (CMO:0001169) 7 19654317 49753746 Rat 7411569 Bw137 Body weight QTL 137 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 21921195 66921195 Rat 1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 10053722 Scort27 Serum corticosterone level QTL 27 2.41 0.0083 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 43228750 88228750 Rat 9590102 Sffal5 Serum free fatty acids level QTL 5 8.62 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 7 5329019 50329019 Rat 1578652 Bmd15 Bone mineral density QTL 15 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 7 9866467 60460686 Rat 1641885 Alcrsp9 Alcohol response QTL 9 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 7 24099606 69099606 Rat 1549840 Bss5 Bone structure and strength QTL 5 9.8 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 24751841 69751841 Rat 10755438 Coatc9 Coat color QTL 9 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 3529280 48529280 Rat 1300127 Srn1 Serum renin concentration QTL 1 3.87 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 7 29409683 84928080 Rat 1358361 Sradr5 Stress Responsive Adrenal Weight QTL 5 5.55 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 7 43747012 108555253 Rat 2298547 Neuinf5 Neuroinflammation QTL 5 3.7 nervous system integrity trait (VT:0010566) spinal cord Cd74 protein level (CMO:0002131) 7 9462246 58265113 Rat 631513 Scl7 Serum cholesterol level QTL 7 4.1 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 37960569 82960569 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 10755440 Coatc10 Coat color QTL 10 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 7496499 52496499 Rat 1354637 Scl30 Serum cholesterol level QTL 30 3.7 blood cholesterol amount (VT:0000180) blood total cholesterol level (CMO:0000051) 7 19654317 49753746 Rat 10755453 Coatc12 Coat color QTL 12 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 31112832 76112832 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 1354639 Spl5 Serum phospholipid level QTL 5 3.9 blood LDL phospholipid amount (VT:0010505) blood low density lipoprotein phospholipid level (CMO:0001568) 7 19654317 52888450 Rat 10755451 Coatc11 Coat color QTL 11 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 17944357 62944357 Rat 634326 Hc3 Hypercalciuria QTL 3 2.1 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 7 42787314 87787314 Rat 2317059 Aia15 Adjuvant induced arthritis QTL 15 2.46 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 17004598 62004598 Rat 7411605 Foco14 Food consumption QTL 14 24.1 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 34293282 79293282 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 738030 Anxrr8 Anxiety related response QTL 8 4.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 46590070 91590070 Rat 1300149 Cm6 Cardiac mass QTL 6 4.09 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 7 43747099 102228765 Rat 631534 Lnnr1 Liver neoplastic nodule remodeling QTL 1 3.85 0.001 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 7 34293282 79293282 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2303629 Vencon3 Ventilatory control QTL 3 7.25 respiration trait (VT:0001943) respiration rate (CMO:0000289) 7 41109692 56793354 Rat 70190 Mcs6 Mammary carcinoma susceptibility QTL 6 2.29 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 7 26737401 63902784 Rat 61428 Scl3 Serum cholesterol level QTL 3 3.2 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 44867533 89867533 Rat 1300132 Bp182 Blood pressure QTL 182 3.49 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 19654317 84928080 Rat 1300138 Hrtrt9 Heart rate QTL 9 4.72 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 29409683 53612950 Rat 10402855 Bp379 Blood pressure QTL 379 0.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 29409683 74409683 Rat 738033 Anxrr6 Anxiety related response QTL 6 4.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 7 15573889 60573889 Rat
RH138744
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 7 48,840,303 - 48,840,896 (+) Marker Load Pipeline mRatBN7.2 7 46,954,046 - 46,954,639 (+) MAPPER mRatBN7.2 Rnor_6.0 7 54,234,074 - 54,234,666 NCBI Rnor6.0 Rnor_5.0 7 54,258,808 - 54,259,400 UniSTS Rnor5.0 RGSC_v3.4 7 50,527,625 - 50,528,217 UniSTS RGSC3.4 Celera 7 43,751,722 - 43,752,314 UniSTS Cytogenetic Map 7 q21 UniSTS
RH134582
Rat Assembly Chr Position (strand) Source JBrowse Rnor_5.0 7 54,260,929 - 54,261,143 NCBI Rnor5.0 RGSC_v3.4 7 50,529,747 - 50,529,960 UniSTS RGSC3.4 Celera 7 43,753,844 - 43,754,057 UniSTS Cytogenetic Map 7 q21 UniSTS
D14S655E
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 46,955,081 - 46,956,484 (+) MAPPER mRatBN7.2 Rnor_6.0 7 54,235,109 - 54,236,511 NCBI Rnor6.0 Rnor_5.0 7 54,259,843 - 54,261,245 UniSTS Rnor5.0 RGSC_v3.4 7 50,528,660 - 50,530,062 UniSTS RGSC3.4 Celera 7 43,752,757 - 43,754,159 UniSTS Cytogenetic Map 7 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000005286 ⟹ ENSRNOP00000005286
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 46,933,375 - 46,956,591 (+) Ensembl Rnor_6.0 Ensembl 7 54,213,319 - 54,236,625 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000106121 ⟹ ENSRNOP00000090697
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 46,933,371 - 46,956,593 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000109635 ⟹ ENSRNOP00000086824
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 46,945,660 - 46,956,593 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000109944 ⟹ ENSRNOP00000087774
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 46,933,360 - 46,956,591 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000114091 ⟹ ENSRNOP00000095957
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 46,933,356 - 46,954,898 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000115155 ⟹ ENSRNOP00000086168
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 46,946,094 - 46,955,166 (+) Ensembl
RefSeq Acc Id:
NM_053561 ⟹ NP_446013
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 48,819,549 - 48,842,856 (+) NCBI mRatBN7.2 7 46,933,292 - 46,956,599 (+) NCBI Rnor_6.0 7 54,213,319 - 54,236,626 (+) NCBI Rnor_5.0 7 54,238,038 - 54,262,614 (+) NCBI RGSC_v3.4 7 50,506,870 - 50,530,177 (+) RGD Celera 7 43,730,965 - 43,754,274 (+) RGD
Sequence:
TTTTTTAGCGCCATCTGCTCGCGGCGCCGCCTCCCGCTCCTCCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCCTGAGTCACTGCCTGCGCAGCTCCGGCCGCTCGGCTCCGCGT
hide sequence
RefSeq Acc Id:
XM_006241342 ⟹ XP_006241404
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 48,819,464 - 48,844,108 (+) NCBI mRatBN7.2 7 46,933,278 - 46,957,853 (+) NCBI Rnor_6.0 7 54,213,305 - 54,237,880 (+) NCBI Rnor_5.0 7 54,238,038 - 54,262,614 (+) NCBI
Sequence:
CGGGCTCTCGGGTCTTTTTTAGCGCCATCTGCTCGCGGCGCCGCCTCCCGCTCCTCCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCCTGAGTCACTGCCTGCGCAGCTCCGGCC
hide sequence
RefSeq Acc Id:
XM_006241343 ⟹ XP_006241405
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 48,819,464 - 48,841,159 (+) NCBI mRatBN7.2 7 46,933,278 - 46,954,902 (+) NCBI Rnor_6.0 7 54,213,305 - 54,234,929 (+) NCBI Rnor_5.0 7 54,238,038 - 54,262,614 (+) NCBI
Sequence:
CGGGCTCTCGGGTCTTTTTTAGCGCCATCTGCTCGCGGCGCCGCCTCCCGCTCCTCCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCCTGAGTCACTGCCTGCGCAGCTCCGGCC
hide sequence
RefSeq Acc Id:
XM_006241344 ⟹ XP_006241406
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 48,819,522 - 48,844,108 (+) NCBI mRatBN7.2 7 46,933,283 - 46,957,853 (+) NCBI Rnor_6.0 7 54,213,374 - 54,237,880 (+) NCBI Rnor_5.0 7 54,238,038 - 54,262,614 (+) NCBI
Sequence:
CGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCCTGAGTCACTGCCTGCGCAGCTCCGGCCGCTCGGCTCCGCGTCCGAGCCTCCTGGAACGATATTTGGAGTTCTTAAAAGATGGCAGACATTGACAAC
hide sequence
RefSeq Acc Id:
XM_063264353 ⟹ XP_063120423
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 48,819,523 - 48,844,108 (+) NCBI
RefSeq Acc Id:
XM_063264354 ⟹ XP_063120424
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 48,819,523 - 48,841,159 (+) NCBI
RefSeq Acc Id:
NP_446013 ⟸ NM_053561
- UniProtKB:
Q9Z2G8 (UniProtKB/Swiss-Prot), A6IGG5 (UniProtKB/TrEMBL)
- Sequence:
MADIDNKEQSELDQDLEDVEEVEEEETGEETKIKARQLTVQMMQNPQILAALQERLDGLVDTPTGYIESLPKVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPT
hide sequence
RefSeq Acc Id:
XP_006241404 ⟸ XM_006241342
- Peptide Label:
isoform X1
- UniProtKB:
Q9Z2G8 (UniProtKB/Swiss-Prot), A6IGG5 (UniProtKB/TrEMBL)
- Sequence:
MADIDNKEQSELDQDLEDVEEVEEEETGEETKIKARQLTVQMMQNPQILAALQERLDGLVDTPT
hide sequence
RefSeq Acc Id:
XP_006241405 ⟸ XM_006241343
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6AKV9 (UniProtKB/TrEMBL), A6IGG9 (UniProtKB/TrEMBL), A6IGH0 (UniProtKB/TrEMBL)
- Sequence:
MADIDNKEQSELDQDLEDVEEVEEEETGEETKIKARQLTVQMMQNPQILAALQERLDGLVDTPTGYIESLPKVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPT
hide sequence
RefSeq Acc Id:
XP_006241406 ⟸ XM_006241344
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6AE93 (UniProtKB/TrEMBL), A6IGG8 (UniProtKB/TrEMBL), A0A8I6A4K3 (UniProtKB/TrEMBL)
- Sequence:
MADIDNLPKVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEVSEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEP
hide sequence
Ensembl Acc Id:
ENSRNOP00000005286 ⟸ ENSRNOT00000005286
Ensembl Acc Id:
ENSRNOP00000090697 ⟸ ENSRNOT00000106121
Ensembl Acc Id:
ENSRNOP00000095957 ⟸ ENSRNOT00000114091
Ensembl Acc Id:
ENSRNOP00000087774 ⟸ ENSRNOT00000109944
Ensembl Acc Id:
ENSRNOP00000086824 ⟸ ENSRNOT00000109635
Ensembl Acc Id:
ENSRNOP00000086168 ⟸ ENSRNOT00000115155
RefSeq Acc Id:
XP_063120423 ⟸ XM_063264353
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6AE93 (UniProtKB/TrEMBL), A6IGG8 (UniProtKB/TrEMBL), A0A8I6A4K3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120424 ⟸ XM_063264354
- Peptide Label:
isoform X4
- UniProtKB:
A6IGH0 (UniProtKB/TrEMBL)
RGD ID: 13695190 Promoter ID: EPDNEW_R5715 Type: initiation region Name: Nap1l1_1 Description: nucleosome assembly protein 1-like 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 54,213,318 - 54,213,378 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-07-09
Nap1l1
nucleosome assembly protein 1-like 1
Symbol and Name updated to reflect Human and Mouse nomenclature
70877 APPROVED
