Symbol:
Myh10
Name:
myosin heavy chain 10
RGD ID:
71000
Description:
Enables identical protein binding activity. Involved in actin filament bundle organization; cell adhesion; and regulation of modification of postsynaptic actin cytoskeleton. Located in lamellipodium. Is active in glutamatergic synapse and postsynaptic actin cytoskeleton. Orthologous to human MYH10 (myosin heavy chain 10); PARTICIPATES IN myocarditis pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
cellular myosin heavy chain type B; cellular myosin heavy chain, type B; MCH-B; MCH-B(B2); myosin heavy chain 10, non-muscle; myosin heavy chain nonmuscle type B; myosin heavy chain, non-muscle IIb; myosin heavy chain, nonmuscle type B; myosin, heavy chain 10, non-muscle; myosin, heavy polypeptide 10, non-muscle; myosin-10; NMMHC II-b; NMMHC-B; NMMHC-IIB; non-muscle myosin heavy chain B; non-muscle myosin heavy chain IIb; nonmuscle myosin heavy chain IIB; nonmuscle myosin heavy chain-B; SMemb
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MYH10 (myosin heavy chain 10) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Myh10 (myosin, heavy polypeptide 10, non-muscle) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Myh10 (myosin heavy chain 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MYH10 (myosin heavy chain 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MYH10 (myosin heavy chain 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Myh10 (myosin heavy chain 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MYH10 (myosin heavy chain 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MYH10 (myosin heavy chain 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Myh10 (myosin heavy chain 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Myh10 (myosin, heavy polypeptide 10, non-muscle)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
MYH10 (myosin heavy chain 10)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
myh10 (myosin, heavy chain 10, non-muscle)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
MYO1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
nmy-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
myh10
Alliance
DIOPT (Ensembl Compara|OMA|PANTHER|PhylomeDB)
Allele / Splice:
Myh10_v1
Myh10_v2
Candidate Gene For:
Vetf10
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 53,891,955 - 54,024,032 (+) NCBI GRCr8 mRatBN7.2 10 53,393,901 - 53,525,174 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 53,394,389 - 53,525,165 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 58,054,246 - 58,186,532 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 57,543,278 - 57,675,562 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 53,052,353 - 53,184,133 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 55,274,910 - 55,406,738 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 55,275,411 - 55,406,732 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 55,017,110 - 55,148,300 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 55,445,288 - 55,576,096 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 55,458,910 - 55,589,717 (+) NCBI Celera 10 52,561,720 - 52,692,270 (+) NCBI Celera Cytogenetic Map 10 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Myh10 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO MYH10 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of MYH10 mRNA CTD PMID:22079256 Myh10 Rat 1,2-dichloroethane affects expression ISO Myh10 (Mus musculus) 6480464 ethylene dichloride affects the expression of MYH10 mRNA CTD PMID:28960355 Myh10 Rat 1,2-dimethylhydrazine increases expression ISO Myh10 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of MYH10 mRNA CTD PMID:22206623 Myh10 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of MYH10 mRNA CTD PMID:30723492 Myh10 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of MYH10 mRNA CTD PMID:17557909 Myh10 Rat 17beta-estradiol multiple interactions ISO MYH10 (Homo sapiens) 6480464 Estradiol affects the localization of and results in increased expression of and results in increased phosphorylation of and affects the activity of MYH10 protein more ... CTD PMID:16901965 Myh10 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of MYH10 mRNA CTD PMID:32145629 Myh10 Rat 17beta-estradiol affects expression ISO MYH10 (Homo sapiens) 6480464 Estradiol affects the expression of MYH10 mRNA CTD PMID:22574217 Myh10 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO MYH10 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Myh10 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of MYH10 mRNA CTD PMID:22298810 and PMID:34747641 Myh10 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MYH10 mRNA CTD PMID:33387578 Myh10 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Myh10 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of MYH10 mRNA CTD PMID:26290441 Myh10 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Myh10 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of MYH10 mRNA CTD PMID:25270620 Myh10 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Myh10 Rat 2,4,6-tribromophenol decreases expression ISO MYH10 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Myh10 Rat 2,6-dimethoxyphenol multiple interactions ISO MYH10 (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Myh10 Rat 2-methylcholine affects expression ISO MYH10 (Homo sapiens) 6480464 beta-methylcholine affects the expression of MYH10 mRNA CTD PMID:21179406 Myh10 Rat 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine increases expression EXP 6480464 Puromycin Aminonucleoside results in increased expression of MYH10 protein CTD PMID:7671567 Myh10 Rat 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine affects expression EXP 6480464 Puromycin Aminonucleoside affects the expression of MYH10 mRNA and Puromycin Aminonucleoside affects the expression of MYH10 protein CTD PMID:7671567 and PMID:8918620 Myh10 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Myh10 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of MYH10 mRNA CTD PMID:24780913 Myh10 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of MYH10 mRNA CTD PMID:31881176 Myh10 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of MYH10 mRNA CTD PMID:23630614 and PMID:25378103 Myh10 Rat aflatoxin B1 increases methylation ISO MYH10 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of MYH10 gene CTD PMID:27153756 Myh10 Rat all-trans-retinoic acid decreases expression ISO MYH10 (Homo sapiens) 6480464 Tretinoin results in decreased expression of MYH10 mRNA CTD PMID:33167477 Myh10 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of MYH10 mRNA CTD PMID:35163327 Myh10 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of MYH10 mRNA CTD PMID:16483693 Myh10 Rat antirheumatic drug increases expression ISO MYH10 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of MYH10 mRNA CTD PMID:24449571 Myh10 Rat aristolochic acid A decreases expression ISO MYH10 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of MYH10 mRNA CTD PMID:33212167 Myh10 Rat arsane increases response to substance ISO MYH10 (Homo sapiens) 6480464 MYH10 mRNA results in increased susceptibility to Arsenic CTD PMID:17976673 Myh10 Rat arsane multiple interactions ISO MYH10 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MYH10 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of MYH10 mRNA CTD PMID:39836092 Myh10 Rat arsane affects methylation ISO MYH10 (Homo sapiens) 6480464 Arsenic affects the methylation of MYH10 gene CTD PMID:25304211 Myh10 Rat arsenic atom increases response to substance ISO MYH10 (Homo sapiens) 6480464 MYH10 mRNA results in increased susceptibility to Arsenic CTD PMID:17976673 Myh10 Rat arsenic atom multiple interactions ISO MYH10 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MYH10 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of MYH10 mRNA CTD PMID:39836092 Myh10 Rat arsenic atom affects methylation ISO MYH10 (Homo sapiens) 6480464 Arsenic affects the methylation of MYH10 gene CTD PMID:25304211 Myh10 Rat arsenite(3-) multiple interactions ISO MYH10 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to MYH10 mRNA] CTD PMID:32406909 Myh10 Rat arsenous acid increases expression ISO MYH10 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of MYH10 mRNA CTD PMID:20458559 Myh10 Rat arsenous acid decreases expression ISO MYH10 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of MYH10 mRNA CTD PMID:26238599 Myh10 Rat atrazine decreases expression ISO MYH10 (Homo sapiens) 6480464 Atrazine results in decreased expression of MYH10 mRNA CTD PMID:22378314 Myh10 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of MYH10 gene CTD PMID:35440735 Myh10 Rat benzo[a]pyrene decreases expression ISO Myh10 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of MYH10 mRNA CTD PMID:17942131 Myh10 Rat benzo[a]pyrene decreases methylation ISO Myh10 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of MYH10 exon and Benzo(a)pyrene results in decreased methylation of MYH10 intron CTD PMID:27901495 Myh10 Rat benzo[a]pyrene increases expression ISO MYH10 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of MYH10 mRNA CTD PMID:30453624 Myh10 Rat benzo[a]pyrene affects methylation ISO MYH10 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of MYH10 5' UTR and Benzo(a)pyrene affects the methylation of MYH10 promoter CTD PMID:27901495 Myh10 Rat benzo[a]pyrene decreases expression ISO MYH10 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of MYH10 mRNA CTD PMID:20106945 and PMID:21632981 Myh10 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of MYH10 mRNA CTD PMID:18164116 Myh10 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Myh10 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of MYH10 mRNA CTD PMID:33754040 Myh10 Rat bisphenol A decreases expression ISO Myh10 (Mus musculus) 6480464 bisphenol A results in decreased expression of MYH10 mRNA CTD PMID:26063408 Myh10 Rat bisphenol A increases expression ISO MYH10 (Homo sapiens) 6480464 bisphenol A results in increased expression of MYH10 protein CTD PMID:37567409 Myh10 Rat bisphenol A affects expression ISO MYH10 (Homo sapiens) 6480464 bisphenol A affects the expression of MYH10 mRNA CTD PMID:30903817 Myh10 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of MYH10 gene CTD PMID:28505145 Myh10 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MYH10 mRNA CTD PMID:25181051 and PMID:32145629 Myh10 Rat bisphenol AF increases expression ISO MYH10 (Homo sapiens) 6480464 bisphenol AF results in increased expression of MYH10 protein CTD PMID:34186270 Myh10 Rat Bisphenol B increases expression ISO MYH10 (Homo sapiens) 6480464 bisphenol B results in increased expression of MYH10 protein CTD PMID:34186270 Myh10 Rat bisphenol F increases expression ISO Myh10 (Mus musculus) 6480464 bisphenol F results in increased expression of MYH10 mRNA CTD PMID:38685157 Myh10 Rat bisphenol F multiple interactions ISO MYH10 (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of MYH10 gene CTD PMID:31601247 Myh10 Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of MYH10 protein CTD PMID:28903499 Myh10 Rat cadmium atom decreases expression ISO MYH10 (Homo sapiens) 6480464 Cadmium results in decreased expression of MYH10 mRNA CTD PMID:23369406 Myh10 Rat cadmium dichloride increases expression ISO MYH10 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of MYH10 mRNA CTD PMID:38382870 Myh10 Rat cadmium dichloride decreases expression ISO MYH10 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of MYH10 mRNA CTD PMID:38568856 Myh10 Rat caffeine affects phosphorylation ISO MYH10 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of MYH10 protein CTD PMID:35688186 Myh10 Rat carbon nanotube decreases expression ISO Myh10 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Myh10 Rat chloropicrin increases expression ISO MYH10 (Homo sapiens) 6480464 chloropicrin results in increased expression of MYH10 mRNA CTD PMID:26352163 Myh10 Rat choline multiple interactions ISO Myh10 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of MYH10 gene CTD PMID:20938992 Myh10 Rat cisplatin decreases expression ISO MYH10 (Homo sapiens) 6480464 Cisplatin results in decreased expression of MYH10 mRNA CTD PMID:19561079 and PMID:27392435 Myh10 Rat cisplatin multiple interactions ISO MYH10 (Homo sapiens) 6480464 [Cisplatin results in decreased susceptibility to Cisplatin] which results in increased expression of MYH10 mRNA CTD PMID:30871063 Myh10 Rat clozapine multiple interactions ISO MYH10 (Homo sapiens) 6480464 [Cuprizone co-treated with Clozapine] results in decreased expression of MYH10 protein CTD PMID:34122009 Myh10 Rat cobalt dichloride decreases expression ISO MYH10 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of MYH10 mRNA CTD PMID:19320972 Myh10 Rat copper atom multiple interactions ISO MYH10 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of MYH10 mRNA CTD PMID:20971185 Myh10 Rat copper(0) multiple interactions ISO MYH10 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of MYH10 mRNA CTD PMID:20971185 Myh10 Rat copper(II) sulfate decreases expression ISO MYH10 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of MYH10 mRNA CTD PMID:19549813 Myh10 Rat coumarin decreases phosphorylation ISO MYH10 (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of MYH10 protein CTD PMID:35688186 Myh10 Rat crocidolite asbestos decreases expression ISO Myh10 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of MYH10 mRNA CTD PMID:29279043 Myh10 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of MYH10 mRNA CTD PMID:26577399 Myh10 Rat Cuprizon multiple interactions ISO MYH10 (Homo sapiens) 6480464 [Cuprizone co-treated with Clozapine] results in decreased expression of MYH10 protein CTD PMID:34122009 Myh10 Rat cyclophosphamide affects response to substance ISO MYH10 (Homo sapiens) 6480464 MYH10 protein affects the susceptibility to Cyclophosphamide CTD PMID:16217747 Myh10 Rat cyclosporin A decreases expression ISO Myh10 (Mus musculus) 6480464 Cyclosporine results in decreased expression of MYH10 mRNA CTD PMID:17942131 and PMID:19770486 Myh10 Rat cyclosporin A decreases expression ISO MYH10 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of MYH10 mRNA CTD PMID:20106945 and PMID:25562108 Myh10 Rat diarsenic trioxide increases expression ISO MYH10 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of MYH10 mRNA CTD PMID:20458559 Myh10 Rat diarsenic trioxide decreases expression ISO MYH10 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of MYH10 mRNA CTD PMID:26238599 Myh10 Rat diazinon increases methylation ISO MYH10 (Homo sapiens) 6480464 Diazinon results in increased methylation of MYH10 gene CTD PMID:22964155 Myh10 Rat Dibutyl phosphate affects expression ISO MYH10 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of MYH10 mRNA CTD PMID:37042841 Myh10 Rat dibutyl phthalate increases expression ISO Myh10 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of MYH10 mRNA CTD PMID:21266533 Myh10 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of MYH10 mRNA CTD PMID:21266533 Myh10 Rat dicrotophos increases expression ISO MYH10 (Homo sapiens) 6480464 dicrotophos results in increased expression of MYH10 mRNA CTD PMID:28302478 Myh10 Rat diethylstilbestrol multiple interactions ISO MYH10 (Homo sapiens) 6480464 Diethylstilbestrol inhibits the reaction [MYH10 protein binds to MYH10 protein] CTD PMID:16901965 Myh10 Rat dioxygen multiple interactions ISO Myh10 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of MYH10 mRNA CTD PMID:30529165 Myh10 Rat doxorubicin affects expression ISO MYH10 (Homo sapiens) 6480464 Doxorubicin affects the expression of MYH10 protein CTD PMID:29385562 Myh10 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of MYH10 mRNA CTD PMID:29391264 Myh10 Rat endosulfan affects expression EXP 6480464 Endosulfan affects the expression of MYH10 protein CTD PMID:31464424 Myh10 Rat enzyme inhibitor multiple interactions ISO MYH10 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of MYH10 protein CTD PMID:23301498 Myh10 Rat ethanol multiple interactions ISO Myh10 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of MYH10 mRNA CTD PMID:30319688 Myh10 Rat folic acid multiple interactions ISO Myh10 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of MYH10 gene CTD PMID:20938992 Myh10 Rat FR900359 affects phosphorylation ISO MYH10 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of MYH10 protein CTD PMID:37730182 Myh10 Rat fulvestrant multiple interactions ISO MYH10 (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of MYH10 gene more ... CTD PMID:16901965 and PMID:31601247 Myh10 Rat furan increases expression EXP 6480464 furan results in increased expression of MYH10 mRNA CTD PMID:25539665 and PMID:27387713 Myh10 Rat furan decreases methylation EXP 6480464 furan results in decreased methylation of MYH10 gene CTD PMID:27387713 Myh10 Rat furfural multiple interactions ISO MYH10 (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Myh10 Rat genistein increases expression ISO MYH10 (Homo sapiens) 6480464 Genistein results in increased expression of MYH10 protein CTD PMID:20884965 Myh10 Rat genistein multiple interactions ISO MYH10 (Homo sapiens) 6480464 ESR1 promotes the reaction [Genistein results in increased expression of MYH10 protein] CTD PMID:20884965 Myh10 Rat graphite affects expression EXP 6480464 Graphite affects the expression of MYH10 mRNA CTD PMID:29933104 Myh10 Rat hydrogen peroxide affects localization ISO MYH10 (Homo sapiens) 6480464 Hydrogen Peroxide affects the localization of MYH10 protein CTD PMID:28343997 Myh10 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of MYH10 mRNA CTD PMID:21396975 Myh10 Rat inulin multiple interactions ISO Myh10 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of MYH10 mRNA CTD PMID:36331819 Myh10 Rat irinotecan decreases expression ISO MYH10 (Homo sapiens) 6480464 Irinotecan analog results in decreased expression of MYH10 mRNA CTD PMID:18927307 Myh10 Rat ivermectin decreases expression ISO MYH10 (Homo sapiens) 6480464 Ivermectin results in decreased expression of MYH10 protein CTD PMID:32959892 Myh10 Rat L-methionine multiple interactions ISO Myh10 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of MYH10 gene CTD PMID:20938992 Myh10 Rat leflunomide decreases expression EXP 6480464 leflunomide results in decreased expression of MYH10 mRNA CTD PMID:24136188 Myh10 Rat manganese atom multiple interactions ISO MYH10 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MYH10 mRNA CTD PMID:39836092 Myh10 Rat manganese(0) multiple interactions ISO MYH10 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MYH10 mRNA CTD PMID:39836092 Myh10 Rat manganese(II) chloride multiple interactions ISO MYH10 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MYH10 mRNA CTD PMID:39836092 Myh10 Rat mercury dichloride increases expression ISO MYH10 (Homo sapiens) 6480464 Mercuric Chloride results in increased expression of MYH10 protein CTD PMID:37172713 Myh10 Rat mercury dichloride increases expression ISO Myh10 (Mus musculus) 6480464 Mercuric Chloride results in increased expression of MYH10 protein CTD PMID:37172713 Myh10 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of MYH10 gene CTD PMID:35440735 Myh10 Rat N-methyl-4-phenylpyridinium increases expression ISO Myh10 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of MYH10 protein CTD PMID:26558463 Myh10 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of MYH10 mRNA CTD PMID:18164116 Myh10 Rat nickel atom decreases expression ISO MYH10 (Homo sapiens) 6480464 Nickel results in decreased expression of MYH10 mRNA CTD PMID:24768652 and PMID:25583101 Myh10 Rat nickel sulfate decreases expression ISO MYH10 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of MYH10 mRNA CTD PMID:16780908 Myh10 Rat nifedipine decreases expression ISO MYH10 (Homo sapiens) 6480464 Nifedipine results in decreased expression of MYH10 protein CTD PMID:20530298 Myh10 Rat nifedipine decreases expression EXP 6480464 Nifedipine results in decreased expression of MYH10 protein CTD PMID:20530298 Myh10 Rat Nor-9-carboxy-delta9-THC multiple interactions ISO MYH10 (Homo sapiens) 6480464 [Cannabinoids results in increased abundance of 11-nor-delta(9)-tetrahydrocannabinol-9-carboxylic acid] which affects the methylation of MYH10 gene CTD PMID:30521419 Myh10 Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of MYH10 mRNA CTD PMID:25729387 Myh10 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of MYH10 mRNA CTD PMID:25729387 Myh10 Rat ozone decreases expression ISO Myh10 (Mus musculus) 6480464 Ozone results in decreased expression of MYH10 mRNA CTD PMID:17095637 Myh10 Rat ozone multiple interactions ISO Myh10 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of MYH10 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of MYH10 mRNA CTD PMID:34911549 Myh10 Rat paracetamol decreases expression ISO Myh10 (Mus musculus) 6480464 Acetaminophen results in decreased expression of MYH10 mRNA CTD PMID:17942131 Myh10 Rat paracetamol affects expression ISO Myh10 (Mus musculus) 6480464 Acetaminophen affects the expression of MYH10 mRNA CTD PMID:17562736 Myh10 Rat paraquat increases expression ISO MYH10 (Homo sapiens) 6480464 Paraquat results in increased expression of MYH10 protein CTD PMID:34064677 Myh10 Rat perfluorooctane-1-sulfonic acid decreases expression ISO Myh10 (Mus musculus) 6480464 perfluorooctane sulfonic acid results in decreased expression of MYH10 protein CTD PMID:26178269 Myh10 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Myh10 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of MYH10 mRNA CTD PMID:36331819 Myh10 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of MYH10 mRNA CTD PMID:35163327 Myh10 Rat pirinixic acid multiple interactions ISO MYH10 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of MYH10 mRNA CTD PMID:19710929 Myh10 Rat pirinixic acid multiple interactions ISO Myh10 (Mus musculus) 6480464 PPARA protein promotes the reaction [pirinixic acid results in decreased expression of MYH10 mRNA] CTD PMID:17950772 Myh10 Rat pirinixic acid decreases expression ISO Myh10 (Mus musculus) 6480464 pirinixic acid results in decreased expression of MYH10 mRNA CTD PMID:17950772 Myh10 Rat potassium chromate decreases expression ISO MYH10 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of MYH10 mRNA CTD PMID:22079256 Myh10 Rat potassium chromate multiple interactions ISO MYH10 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of MYH10 mRNA CTD PMID:22079256 Myh10 Rat progesterone decreases expression ISO MYH10 (Homo sapiens) 6480464 Progesterone results in decreased expression of MYH10 mRNA CTD PMID:21795739 Myh10 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of MYH10 protein CTD PMID:35544339 Myh10 Rat simvastatin decreases expression ISO MYH10 (Homo sapiens) 6480464 Simvastatin results in decreased expression of MYH10 protein CTD PMID:16005304 Myh10 Rat sodium arsenate increases expression ISO Myh10 (Mus musculus) 6480464 sodium arsenate results in increased expression of MYH10 mRNA CTD PMID:21795629 Myh10 Rat sodium arsenite decreases expression ISO Myh10 (Mus musculus) 6480464 sodium arsenite results in decreased expression of MYH10 mRNA CTD PMID:31170414 Myh10 Rat sodium arsenite multiple interactions ISO MYH10 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of MYH10 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of MYH10 mRNA CTD PMID:39836092 Myh10 Rat sodium arsenite decreases expression ISO MYH10 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of MYH10 mRNA CTD PMID:34032870 and PMID:38568856 Myh10 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of MYH10 protein CTD PMID:29459688 Myh10 Rat sodium chloride multiple interactions ISO MYH10 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of MYH10 protein more ... CTD PMID:38598786 Myh10 Rat sulindac sulfide increases expression ISO MYH10 (Homo sapiens) 6480464 sulindac sulfide results in increased expression of MYH10 mRNA CTD PMID:12734198 Myh10 Rat sunitinib decreases expression ISO MYH10 (Homo sapiens) 6480464 Sunitinib results in decreased expression of MYH10 mRNA CTD PMID:31533062 Myh10 Rat tamoxifen multiple interactions ISO MYH10 (Homo sapiens) 6480464 Tamoxifen inhibits the reaction [Estradiol results in increased expression of MYH10 protein] CTD PMID:16901965 Myh10 Rat tetrachloromethane affects expression ISO Myh10 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of MYH10 mRNA CTD PMID:17484886 Myh10 Rat tetrachloromethane increases expression ISO Myh10 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of MYH10 mRNA CTD PMID:31919559 Myh10 Rat thapsigargin decreases expression ISO MYH10 (Homo sapiens) 6480464 Thapsigargin results in decreased expression of MYH10 mRNA CTD PMID:22378314 Myh10 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of MYH10 mRNA CTD PMID:23411599 Myh10 Rat titanium dioxide decreases expression ISO Myh10 (Mus musculus) 6480464 titanium dioxide results in decreased expression of MYH10 mRNA CTD PMID:29264374 Myh10 Rat titanium dioxide decreases methylation ISO Myh10 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of MYH10 gene and titanium dioxide results in decreased methylation of MYH10 promoter CTD PMID:35295148 Myh10 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of MYH10 mRNA CTD PMID:25729387 Myh10 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of MYH10 mRNA CTD PMID:25729387 Myh10 Rat Tributyltin oxide decreases expression ISO Myh10 (Mus musculus) 6480464 bis(tri-n-butyltin)oxide results in decreased expression of MYH10 mRNA CTD PMID:17942131 Myh10 Rat troglitazone decreases expression ISO Myh10 (Mus musculus) 6480464 troglitazone results in decreased expression of MYH10 mRNA CTD PMID:28973697 Myh10 Rat trovafloxacin increases expression ISO Myh10 (Mus musculus) 6480464 trovafloxacin results in increased expression of MYH10 mRNA CTD PMID:35537566 Myh10 Rat tunicamycin decreases expression ISO MYH10 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of MYH10 mRNA CTD PMID:22378314 Myh10 Rat valproic acid affects expression ISO Myh10 (Mus musculus) 6480464 Valproic Acid affects the expression of MYH10 mRNA CTD PMID:17292431 and PMID:17963808 Myh10 Rat valproic acid decreases methylation ISO MYH10 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of MYH10 gene CTD PMID:29154799 Myh10 Rat valproic acid affects expression ISO MYH10 (Homo sapiens) 6480464 Valproic Acid affects the expression of MYH10 mRNA CTD PMID:25979313 Myh10 Rat vinclozolin decreases methylation EXP 6480464 vinclozolin results in decreased methylation of MYH10 gene CTD PMID:30207508 Myh10 Rat vorinostat decreases expression ISO MYH10 (Homo sapiens) 6480464 vorinostat results in decreased expression of MYH10 mRNA CTD PMID:27188386
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4,6-tribromophenol (ISO) 2,6-dimethoxyphenol (ISO) 2-methylcholine (ISO) 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (EXP,ISO) benzo[a]pyrene (ISO) beta-naphthoflavone (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) Brodifacoum (EXP) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) carbon nanotube (ISO) chloropicrin (ISO) choline (ISO) cisplatin (ISO) clozapine (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) coumarin (ISO) crocidolite asbestos (ISO) Cuprizon (EXP,ISO) cyclophosphamide (ISO) cyclosporin A (ISO) diarsenic trioxide (ISO) diazinon (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dicrotophos (ISO) diethylstilbestrol (ISO) dioxygen (ISO) doxorubicin (ISO) endosulfan (EXP) enzyme inhibitor (ISO) ethanol (ISO) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) furan (EXP) furfural (ISO) genistein (ISO) graphite (EXP) hydrogen peroxide (ISO) indole-3-methanol (EXP) inulin (ISO) irinotecan (ISO) ivermectin (ISO) L-methionine (ISO) leflunomide (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) mercury dichloride (ISO) methoxychlor (EXP) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP) nickel atom (ISO) nickel sulfate (ISO) nifedipine (EXP,ISO) Nor-9-carboxy-delta9-THC (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (ISO) paraquat (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) pirinixic acid (ISO) potassium chromate (ISO) progesterone (ISO) rotenone (EXP) simvastatin (ISO) sodium arsenate (ISO) sodium arsenite (EXP,ISO) sodium chloride (ISO) sulindac sulfide (ISO) sunitinib (ISO) tamoxifen (ISO) tetrachloromethane (ISO) thapsigargin (ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) Tributyltin oxide (ISO) troglitazone (ISO) trovafloxacin (ISO) tunicamycin (ISO) valproic acid (ISO) vinclozolin (EXP) vorinostat (ISO)
Biological Process
actin cytoskeleton organization (IEA,ISO) actin filament bundle assembly (IMP) actin filament bundle distribution (IMP) actin filament-based movement (IEA,ISO) actomyosin structure organization (IBA,IEA,ISO) adult heart development (IEA,ISO) aorta development (IEA,ISO) axon guidance (IEA,ISO) axonogenesis (IEA,ISO) brain development (IEA,ISO) cardiac muscle cell proliferation (IEA,ISO) cardiac myofibril assembly (IEA,ISO) cardiac septum development (IEA,ISO) cell adhesion (IDA,IEA) cerebellar Purkinje cell layer development (IEA,ISO) coronary vasculature development (IEA,ISO) exocytosis (IEA,ISO) fourth ventricle development (IEA,ISO) heart development (IEA,ISO) in utero embryonic development (IEA,ISO) lateral ventricle development (IEA,ISO) mitotic cytokinesis (IBA,IEA,ISO) myofibril assembly (IEA,ISO) neuromuscular process controlling balance (IEA,ISO) neuron migration (IEA,ISO) neuron projection development (IEA,ISO) nuclear migration (IEA,ISO) plasma membrane repair (IEA,ISO) positive regulation of protein secretion (IEA,ISO) postsynaptic actin cytoskeleton organization (IEA,ISO) regulation of cell shape (IBA,IEA,ISO) regulation of modification of postsynaptic actin cytoskeleton (IDA,IMP) retina development in camera-type eye (IEA,ISO) substrate-dependent cell migration, cell extension (IEA,ISO) symbiont entry into host cell (IEA,ISO) third ventricle development (IEA,ISO) ventricular cardiac muscle cell development (IEA,ISO)
Cellular Component
actomyosin (IEA,ISO) axon (IEA,ISO) brush border (IEA,ISO) cell cortex (IEA,ISO) cell projection (IEA) cell surface (IEA,ISO) cleavage furrow (IEA,ISO) cytoplasm (IBA,IEA,ISO) cytoplasmic side of plasma membrane (IEA,ISO) cytosol (IEA,ISO) dendritic spine (IEA,ISO) glutamatergic synapse (IDA,IEA,IMP,ISO) growth cone (IEA,ISO) intracellular membraneless organelle (IEA) lamellipodium (IDA,IEA) midbody (IEA,ISO) myosin complex (IEA,ISO) myosin filament (IBA) myosin II complex (IBA,IEA,ISO) myosin II filament (IEA,ISO) neuromuscular junction (IEA,ISO) neuron projection (IEA,ISO) neuronal cell body (IEA,ISO) postsynaptic actin cytoskeleton (IDA,IEA,ISO) sarcoplasm (IEA,ISO) spindle (IEA,ISO) stress fiber (IEA,ISO)
Molecular Function
actin binding (IEA) actin filament binding (IBA,IEA,ISO) ADP binding (IEA,ISO) ATP binding (IEA,ISO) calmodulin binding (IEA) cytoskeletal motor activity (IEA) identical protein binding (IDA) microfilament motor activity (IBA,IEA,ISO) mRNA 5'-UTR binding (IEA,ISO) nucleotide binding (IEA) protein binding (IPI,ISO) RNA stem-loop binding (IEA,ISO) virus receptor activity (IEA,ISO)
1.
Gas6-Axl Pathway. The Role of Redox-Dependent Association of Axl With Nonmuscle Myosin IIB.
Cavet ME, etal., Hypertension. 2010 May 17.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Microtubule guidance tested through controlled cell geometry.
Huda S, etal., J Cell Sci. 2012 Dec 1;125(Pt 23):5790-9. doi: 10.1242/jcs.110494. Epub 2012 Sep 19.
5.
Neuronal cell expression of inserted isoforms of vertebrate nonmuscle myosin heavy chain II-B.
Itoh K and Adelstein RS, J Biol Chem 1995 Jun 16;270(24):14533-40.
6.
Molecular architecture of synaptic actin cytoskeleton in hippocampal neurons reveals a mechanism of dendritic spine morphogenesis.
Korobova F and Svitkina T, Mol Biol Cell. 2010 Jan 1;21(1):165-76. doi: 10.1091/mbc.e09-07-0596. Epub 2009 Nov 4.
7.
Gene Data Set
MGD Curation, June 12, 2002
8.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
9.
Podocyte expression of nonmuscle myosin heavy chain-IIA decreases in idiopathic nephrotic syndrome, especially in focal segmental glomerulosclerosis.
Miura K, etal., Nephrol Dial Transplant. 2013 Dec;28(12):2993-3003. doi: 10.1093/ndt/gft350. Epub 2013 Sep 15.
10.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
12.
Myosin IIb regulates actin dynamics during synaptic plasticity and memory formation.
Rex CS, etal., Neuron. 2010 Aug 26;67(4):603-17. doi: 10.1016/j.neuron.2010.07.016.
13.
GOA pipeline
RGD automated data pipeline
14.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
16.
Endogenous species of mammalian nonmuscle myosin IIA and IIB include activated monomers and heteropolymers.
Shutova MS, etal., Curr Biol. 2014 Sep 8;24(17):1958-68. doi: 10.1016/j.cub.2014.07.070. Epub 2014 Aug 14.
17.
Developmentally regulated expression of a nonmuscle myosin heavy chain IIB inserted isoform in rat brain.
Takahashi M, etal., Biochem Biophys Res Commun 1999 May 27;259(1):29-33.
18.
Molecular cloning and functional analysis of the promoter region of rat nonmuscle myosin heavy chain-B gene.
Yam JW, etal., Biochem Biophys Res Commun 2000 Oct 5;276(3):1203-9.
Myh10 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 53,891,955 - 54,024,032 (+) NCBI GRCr8 mRatBN7.2 10 53,393,901 - 53,525,174 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 53,394,389 - 53,525,165 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 58,054,246 - 58,186,532 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 57,543,278 - 57,675,562 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 53,052,353 - 53,184,133 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 55,274,910 - 55,406,738 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 55,275,411 - 55,406,732 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 55,017,110 - 55,148,300 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 55,445,288 - 55,576,096 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 55,458,910 - 55,589,717 (+) NCBI Celera 10 52,561,720 - 52,692,270 (+) NCBI Celera Cytogenetic Map 10 q24 NCBI
MYH10 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 8,474,212 - 8,630,725 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 8,474,207 - 8,631,376 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 8,377,530 - 8,534,043 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 8,318,255 - 8,474,761 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 8,318,254 - 8,474,761 NCBI Celera 17 8,408,358 - 8,564,898 (-) NCBI Celera Cytogenetic Map 17 p13.1 NCBI HuRef 17 8,276,713 - 8,433,166 (-) NCBI HuRef CHM1_1 17 8,386,377 - 8,542,853 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 8,380,372 - 8,536,822 (-) NCBI T2T-CHM13v2.0
Myh10 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 68,581,228 - 68,707,451 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 68,582,385 - 68,707,458 (+) Ensembl GRCm39 Ensembl GRCm38 11 68,691,915 - 68,816,626 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 68,691,559 - 68,816,632 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 68,505,417 - 68,630,126 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 68,508,162 - 68,632,737 (+) NCBI MGSCv36 mm8 Celera 11 75,631,165 - 75,761,610 (+) NCBI Celera Cytogenetic Map 11 B3 NCBI cM Map 11 41.95 NCBI
Myh10 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955467 8,298,527 - 8,427,459 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955467 8,298,514 - 8,427,459 (+) NCBI ChiLan1.0 ChiLan1.0
MYH10 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 65,118,242 - 65,274,685 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 69,927,439 - 70,084,120 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 43,023,922 - 43,180,159 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 47,756,244 - 47,912,747 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 47,761,322 - 47,911,192 (+) Ensembl panpan1.1 panPan2
MYH10 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 33,239,800 - 33,360,459 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 33,241,266 - 33,360,934 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 33,375,328 - 33,497,290 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 33,342,579 - 33,463,814 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 33,342,582 - 33,463,639 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 33,309,962 - 33,431,940 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 33,265,077 - 33,387,053 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 33,444,924 - 33,565,595 (-) NCBI UU_Cfam_GSD_1.0
Myh10 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 48,223,102 - 48,358,045 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936595 1,694,102 - 1,832,364 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936595 1,697,283 - 1,832,571 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MYH10
MYH10 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 7,837,527 - 7,989,687 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 7,835,843 - 7,989,788 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 13,394,355 - 13,546,918 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Myh10
.
Predicted Target Of
Count of predictions: 244 Count of miRNA genes: 150 Interacting mature miRNAs: 198 Transcripts: ENSRNOT00000065895 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 152025227 Bw195 Body weight QTL 195 5.73 body mass (VT:0001259) 10 46989699 68663659 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 152025224 Bw193 Body weight QTL 193 6.47 body mass (VT:0001259) 10 51663405 75085664 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 1578762 Toxo1 Toxoplasma gondii resistance QTL 1 brain integrity trait (VT:0010579) percentage of study population displaying Toxoplasma gondii brain cysts at a point in time (CMO:0002028) 10 52200030 59378278 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat
MARC_24284-24285:1030045561:1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 53,524,497 - 53,525,008 (+) MAPPER mRatBN7.2 Rnor_6.0 10 55,406,065 - 55,406,575 NCBI Rnor6.0 Rnor_5.0 10 55,147,627 - 55,148,137 UniSTS Rnor5.0 RGSC_v3.4 10 55,575,427 - 55,575,937 UniSTS RGSC3.4 Celera 10 52,691,601 - 52,692,111 UniSTS Cytogenetic Map 10 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000065895 ⟹ ENSRNOP00000062744
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 53,394,389 - 53,525,165 (+) Ensembl Rnor_6.0 Ensembl 10 55,275,411 - 55,406,732 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000105761 ⟹ ENSRNOP00000077816
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 53,394,841 - 53,525,165 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000107493 ⟹ ENSRNOP00000095410
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 53,394,389 - 53,525,165 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000109864 ⟹ ENSRNOP00000090090
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 53,394,389 - 53,525,165 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000113616 ⟹ ENSRNOP00000087937
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 53,394,389 - 53,525,165 (+) Ensembl
RefSeq Acc Id:
NM_031520 ⟹ NP_113708
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 53,893,264 - 54,024,032 (+) NCBI mRatBN7.2 10 53,394,389 - 53,525,167 (+) NCBI Rnor_6.0 10 55,275,411 - 55,406,734 (+) NCBI Rnor_5.0 10 55,017,110 - 55,148,300 (+) NCBI RGSC_v3.4 10 55,445,288 - 55,576,096 (+) RGD Celera 10 52,561,720 - 52,692,270 (+) RGD
Sequence:
GCGTGGAGCTGGCCCAATGAGGGTGGGAGTGGGTGGGGCAGGCGCGAGCGGCAGTGCTAAAGGAGCCCGGCGGAGGCAGCGGTGGGTTTGGAACTGAGACGCTGGATCTTTGGTCGCTGCTGGGGACG
hide sequence
RefSeq Acc Id:
XM_017597544 ⟹ XP_017453033
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 53,891,955 - 54,023,950 (+) NCBI mRatBN7.2 10 53,393,901 - 53,523,654 (+) NCBI Rnor_6.0 10 55,274,910 - 55,406,738 (+) NCBI
Sequence:
TTCCACTGTGAAAGCCGGTCCCGCTGAGGGACCCAGTGGCTGCGGCAAGCCAACGGGCCGCAGAACGCTCGAGTGGGTAGCAGCGGCGAACCGACGCTACAGAGAGACGTGACCAGTGGGAGCTGGTG
hide sequence
RefSeq Acc Id:
XM_063269925 ⟹ XP_063125995
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 53,894,229 - 54,023,950 (+) NCBI
RefSeq Acc Id:
XM_063269926 ⟹ XP_063125996
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 53,892,797 - 54,023,950 (+) NCBI
RefSeq Acc Id:
XM_063269927 ⟹ XP_063125997
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 53,892,797 - 54,023,950 (+) NCBI
RefSeq Acc Id:
XM_063269928 ⟹ XP_063125998
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 53,892,798 - 54,023,950 (+) NCBI
RefSeq Acc Id:
XM_063269929 ⟹ XP_063125999
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 53,894,229 - 54,023,950 (+) NCBI
RefSeq Acc Id:
NP_113708 ⟸ NM_031520
- UniProtKB:
Q9JLT0 (UniProtKB/Swiss-Prot), A6HFL0 (UniProtKB/TrEMBL)
- Sequence:
MAQRTGLEDPERYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMVELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPY
hide sequence
RefSeq Acc Id:
XP_017453033 ⟸ XM_017597544
- Peptide Label:
isoform X1
- UniProtKB:
Q9JLT0 (UniProtKB/Swiss-Prot), A0A8I6GLM0 (UniProtKB/TrEMBL)
- Sequence:
MAQRTGLEDPERYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMVELAE
hide sequence
Ensembl Acc Id:
ENSRNOP00000062744 ⟸ ENSRNOT00000065895
Ensembl Acc Id:
ENSRNOP00000087937 ⟸ ENSRNOT00000113616
Ensembl Acc Id:
ENSRNOP00000077816 ⟸ ENSRNOT00000105761
Ensembl Acc Id:
ENSRNOP00000090090 ⟸ ENSRNOT00000109864
Ensembl Acc Id:
ENSRNOP00000095410 ⟸ ENSRNOT00000107493
RefSeq Acc Id:
XP_063125997 ⟸ XM_063269927
- Peptide Label:
isoform X3
- UniProtKB:
Q9JLT0 (UniProtKB/Swiss-Prot), G3V9Y1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063125996 ⟸ XM_063269926
- Peptide Label:
isoform X2
- UniProtKB:
Q9JLT0 (UniProtKB/Swiss-Prot), A0A8I6A5G4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063125998 ⟸ XM_063269928
- Peptide Label:
isoform X4
- UniProtKB:
Q9JLT0 (UniProtKB/Swiss-Prot), A6HFL0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063125995 ⟸ XM_063269925
- Peptide Label:
isoform X1
- UniProtKB:
Q9JLT0 (UniProtKB/Swiss-Prot), A0A8I6GLM0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063125999 ⟸ XM_063269929
- Peptide Label:
isoform X4
- UniProtKB:
Q9JLT0 (UniProtKB/Swiss-Prot), A6HFL0 (UniProtKB/TrEMBL)
RGD ID: 13697299 Promoter ID: EPDNEW_R7822 Type: initiation region Name: Myh10_1 Description: myosin heavy chain 10 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 55,275,500 - 55,275,560 EPDNEW
BioCyc Gene G2FUF-24626 BioCyc
Ensembl Genes ENSRNOG00000002886 Ensembl, ENTREZGENE
Ensembl Transcript ENSRNOT00000065895 ENTREZGENE
ENSRNOT00000105761 ENTREZGENE
ENSRNOT00000107493 ENTREZGENE
ENSRNOT00000109864 ENTREZGENE
ENSRNOT00000113616 ENTREZGENE
Gene3D-CATH 1.10.10.820 UniProtKB/Swiss-Prot
1.10.287.1490 UniProtKB/Swiss-Prot
1.20.5.340 UniProtKB/Swiss-Prot
1.20.5.4820 UniProtKB/Swiss-Prot
1.20.58.530 UniProtKB/Swiss-Prot
2.30.30.360 UniProtKB/Swiss-Prot
3.40.850.10 UniProtKB/Swiss-Prot
6.10.250.2420 UniProtKB/Swiss-Prot
Myosin VI head, motor domain, U50 subdomain UniProtKB/Swiss-Prot
InterPro IQ_motif_EF-hand-BS UniProtKB/Swiss-Prot
Kinesin_motor_dom_sf UniProtKB/Swiss-Prot
Myosin_head_motor_dom UniProtKB/Swiss-Prot
Myosin_N UniProtKB/Swiss-Prot
Myosin_S1_N UniProtKB/Swiss-Prot
Myosin_tail UniProtKB/Swiss-Prot
P-loop_NTPase UniProtKB/Swiss-Prot
KEGG Report rno:79433 UniProtKB/Swiss-Prot
NCBI Gene 79433 ENTREZGENE
PANTHER MYOSIN HEAVY CHAIN, NON-MUSCLE UniProtKB/Swiss-Prot
MYOSIN-10 UniProtKB/Swiss-Prot
Pfam Myosin_head UniProtKB/Swiss-Prot
Myosin_N UniProtKB/Swiss-Prot
Myosin_tail_1 UniProtKB/Swiss-Prot
PF00612 UniProtKB/Swiss-Prot
PhenoGen Myh10 PhenoGen
PRINTS MYOSINHEAVY UniProtKB/Swiss-Prot
PROSITE MYOSIN_MOTOR UniProtKB/Swiss-Prot
PS50096 UniProtKB/Swiss-Prot
SH3_LIKE UniProtKB/Swiss-Prot
RatGTEx ENSRNOG00000002886 RatGTEx
SMART MYSc UniProtKB/Swiss-Prot
SM00015 UniProtKB/Swiss-Prot
Superfamily-SCOP Myosin rod fragments UniProtKB/Swiss-Prot
Myosin S1 fragment, N-terminal domain UniProtKB/Swiss-Prot
SSF52540 UniProtKB/Swiss-Prot
UniProt A0A8I5ZJL1_RAT UniProtKB/TrEMBL
A0A8I6A5G4 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6A9E0_RAT UniProtKB/TrEMBL
A0A8I6GLM0 ENTREZGENE, UniProtKB/TrEMBL
A6HFL0 ENTREZGENE, UniProtKB/TrEMBL
A6HFL1_RAT UniProtKB/TrEMBL
G3V9Y1 ENTREZGENE, UniProtKB/TrEMBL
MYH10_RAT UniProtKB/Swiss-Prot, ENTREZGENE
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-08-29
Myh10
myosin heavy chain 10
Myh10
myosin, heavy chain 10, non-muscle
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-10-23
Myh10
myosin, heavy chain 10, non-muscle
Myh10
myosin, heavy polypeptide 10, non-muscle
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Myh10
myosin, heavy polypeptide 10, non-muscle
myosin heavy chain 10, non-muscle
Name updated
1299863 APPROVED
2002-07-09
Myh10
myosin heavy chain 10, non-muscle
Symbol and Name updated to reflect Human and Mouse nomenclature
70877 APPROVED
