Advanced Search (OLGA)

Gene: Bmp15 (bone morphogenetic protein 15) Rattus norvegicus

Analyze

Symbol:

Bmp15

Name:

bone morphogenetic protein 15

RGD ID:

70990

Description:

Predicted to enable cytokine activity. Involved in positive regulation of DNA-templated transcription. Predicted to be located in cytoplasm. Predicted to be active in extracellular space. Human ortholog(s) of this gene implicated in ovarian dysgenesis 2 and primary ovarian insufficiency. Orthologous to human BMP15 (bone morphogenetic protein 15); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Gdf-9b; growth differentiation factor-9B

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	BMP15 (bone morphogenetic protein 15)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Bmp15 (bone morphogenetic protein 15)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Bmp15 (bone morphogenetic protein 15)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	BMP15 (bone morphogenetic protein 15)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	BMP15 (bone morphogenetic protein 15)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Bmp15 (bone morphogenetic protein 15)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	BMP15 (bone morphogenetic protein 15)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	BMP15 (bone morphogenetic protein 15)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Bmp15 (bone morphogenetic protein 15)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	BMP15 (bone morphogenetic protein 15)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Bmp15 (bone morphogenetic protein 15)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	bmp15 (bone morphogenetic protein 15)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	bmp15	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	18,840,943 - 18,846,006 (+)	NCBI		GRCr8
mRatBN7.2	X	16,169,123 - 16,174,187 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	16,169,123 - 16,174,187 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	X	20,981,822 - 20,986,886 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	19,096,380 - 19,101,444 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	15,361,328 - 15,366,392 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	17,016,831 - 17,021,894 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	17,016,778 - 17,023,418 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	X	17,797,360 - 17,802,423 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	29,003,933 - 29,008,996 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	X	29,057,401 - 29,062,465 (-)	NCBI
Celera	X	16,238,220 - 16,243,279 (+)	NCBI		Celera
Cytogenetic Map	X	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

amenorrhea (ISO)

autistic disorder (ISO)

congenital disorder of glycosylation type IIm (ISO)

genetic disease (ISO)

hereditary breast ovarian cancer syndrome (ISO)

immune dysregulation-polyendocrinopathy-enteropathy-X-linked syndrome (ISO)

neurodegeneration with brain iron accumulation 5 (ISO)

ovarian dysgenesis 2 (ISO)

polycystic ovary syndrome (ISO)

Postmenopausal Osteoporosis (ISO)

primary ovarian insufficiency (ISO)

primary ovarian insufficiency 16 (ISO)

Stocco Dos Santos type X-linked intellectual disability (ISO)

syndromic X-linked intellectual disability Lubs type (ISO)

Thrombocytopenia 1 (ISO)

Wiskott-Aldrich syndrome (ISO)

X-linked epilepsy with variable learning disabilities and behavior disorders (ISO)

X-linked severe congenital neutropenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (EXP,ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3-methylcholanthrene (EXP)

4,4'-diaminodiphenylmethane (ISO)

5-azacytidine (ISO)

alpha-naphthoflavone (EXP)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

CGP 52608 (ISO)

Chloroacetonitrile (ISO)

chlorothalonil (ISO)

chlorpyrifos (ISO)

copper atom (EXP)

copper(0) (EXP)

decabromodiphenyl ether (EXP)

dimethomorph (EXP)

glycidol (EXP)

paracetamol (ISO)

paraquat (EXP)

perfluorooctane-1-sulfonic acid (EXP)

pirinixic acid (ISO)

potassium dichromate (EXP)

progesterone (EXP)

resveratrol (ISO)

sodium arsenite (ISO)

Theaflavin 3,3'-digallate (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

ovarian cumulus expansion (ISO)

positive regulation of DNA-templated transcription (IDA)

signal transduction (IEA)

Cellular Component

cytoplasm (ISO)

extracellular space (IBA)

Molecular Function

cytokine activity (IBA)

growth factor activity (IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Missense mutations in the BMP15 gene are associated with ovarian failure.	Dixit H, etal., Hum Genet. 2006 May;119(4):408-15. Epub 2006 Mar 1.
2.	Mutations in an oocyte-derived growth factor gene (BMP15) cause increased ovulation rate and infertility in a dosage-sensitive manner.	Galloway SM, etal., Nat Genet 2000 Jul;25(3):279-83.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Localization of growth differentiation factor-9 (GDF-9) mRNA and protein in rat ovaries and cDNA cloning of rat GDF-9 and its novel homolog GDF-9B.	Jaatinen R, etal., Mol Cell Endocrinol 1999 Oct 25;156(1-2):189-93.
6.	Estrogen-related genes and postmenopausal osteoporosis risk.	Mendoza N, etal., Climacteric. 2012 Dec;15(6):587-93. doi: 10.3109/13697137.2012.656160. Epub 2012 Feb 15.
7.	Gene Data Set	MGD Curation, June 12, 2002
8.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
9.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
11.	A novel function of bone morphogenetic protein-15 in the pituitary: selective synthesis and secretion of FSH by gonadotropes.	Otsuka F and Shimasaki S, Endocrinology 2002 Dec;143(12):4938-41.
12.	A negative feedback system between oocyte bone morphogenetic protein 15 and granulosa cell kit ligand: its role in regulating granulosa cell mitosis.	Otsuka F and Shimasaki S, Proc Natl Acad Sci U S A 2002 Jun 11;99(12):8060-5.
13.	GOA pipeline	RGD automated data pipeline
14.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
16.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:14970198	PMID:18063682	PMID:19106224	PMID:19480014	PMID:20937357	PMID:37026063	PMID:37585996

Genomics

Comparative Map Data

Bmp15
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	18,840,943 - 18,846,006 (+)	NCBI		GRCr8
mRatBN7.2	X	16,169,123 - 16,174,187 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	16,169,123 - 16,174,187 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	X	20,981,822 - 20,986,886 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	19,096,380 - 19,101,444 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	15,361,328 - 15,366,392 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	17,016,831 - 17,021,894 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	17,016,778 - 17,023,418 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	X	17,797,360 - 17,802,423 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	29,003,933 - 29,008,996 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	X	29,057,401 - 29,062,465 (-)	NCBI
Celera	X	16,238,220 - 16,243,279 (+)	NCBI		Celera
Cytogenetic Map	X	q12	NCBI

BMP15
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	X	50,910,735 - 50,916,641 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	X	50,910,735 - 50,916,641 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	X	50,653,735 - 50,659,641 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	X	50,670,524 - 50,676,347 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	X	50,486,819 - 50,492,643	NCBI
Celera	X	54,697,190 - 54,703,096 (+)	NCBI		Celera
Cytogenetic Map	X	p11.22	NCBI
HuRef	X	48,097,311 - 48,103,406 (+)	NCBI		HuRef
CHM1_1	X	50,733,338 - 50,739,244 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	X	50,181,955 - 50,187,861 (+)	NCBI		T2T-CHM13v2.0

Bmp15
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	X	6,226,108 - 6,232,778 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	X	6,226,161 - 6,232,775 (-)	Ensembl		GRCm39 Ensembl
GRCm38	X	6,314,054 - 6,320,724 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	X	6,314,107 - 6,320,721 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	X	5,891,224 - 5,897,841 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	X	5,489,598 - 5,496,190 (-)	NCBI		MGSCv36	mm8
Celera	X	5,090,389 - 5,097,007 (+)	NCBI		Celera
Cytogenetic Map	X	A1.1	NCBI
cM Map	X	2.81	NCBI

Bmp15
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955543	2,339,659 - 2,345,406 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955543	2,304,112 - 2,345,376 (+)	NCBI	ChiLan1.0	ChiLan1.0

BMP15
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	X	52,284,905 - 52,291,966 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	X	52,288,509 - 52,295,570 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	X	43,071,039 - 43,076,941 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	X	50,783,925 - 50,789,830 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	X	50,783,925 - 50,791,369 (+)	Ensembl	panpan1.1		panPan2

BMP15
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	X	43,765,126 - 43,771,277 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	X	43,764,777 - 43,771,287 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	X	18,142,461 - 18,147,409 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	X	43,885,645 - 43,890,593 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	X	43,885,666 - 43,890,593 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UNSW_CanFamBas_1.0	X	43,877,414 - 43,882,362 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	X	43,972,394 - 43,977,342 (+)	NCBI		UU_Cfam_GSD_1.0

Bmp15
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	X	36,301,604 - 36,318,300 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936873	109,156 - 115,498 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BMP15
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	X	44,613,122 - 44,620,575 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	X	44,613,122 - 44,620,575 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	X	49,544,707 - 49,550,877 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

BMP15
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	X	47,713,434 - 47,722,818 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	X	47,713,957 - 47,719,777 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666086	1,314,361 - 1,320,255 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Bmp15
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624893	3,014,989 - 3,021,746 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624893	3,014,535 - 3,020,862 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Bmp15
6 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	27
Count of miRNA genes:	27
Interacting mature miRNAs:	27
Transcripts:	ENSRNOT00000003989
Prediction methods:	Miranda, Pita, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70165	Bp64	Blood pressure QTL 64	5.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	X	1448129	31706553	Rat
1298071	Edpm12	Estrogen-dependent pituitary mass QTL 12	3.2		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	X	2927898	47927898	Rat
731181	Uae27	Urinary albumin excretion QTL 27	2.7	0.0059	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	X	1	43491017	Rat
61430	Cia18	Collagen induced arthritis QTL 18	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	X	14843113	120568734	Rat
10755455	Coatc13	Coat color QTL 13		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	4406000	49406000	Rat
631666	Iddm5	Insulin dependent diabetes mellitus QTL 5			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	X	4494549	49494549	Rat
634325	Bw13	Body weight QTL 13	0		body mass (VT:0001259)	body weight (CMO:0000012)	X	1447972	20991088	Rat
631204	Gluco15	Glucose level QTL 15		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	X	1623715	22646544	Rat
71116	Niddm16	Non-insulin dependent diabetes mellitus QTL 16	7.81		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	X	15297802	60297802	Rat

Markers in Region

UniSTS:496638

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	X	16,173,614 - 16,173,878 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	17,021,322 - 17,021,585	NCBI	Rnor6.0
Rnor_5.0	X	17,801,851 - 17,802,114	UniSTS	Rnor5.0
RGSC_v3.4	X	29,004,242 - 29,004,505	UniSTS	RGSC3.4
Celera	X	16,242,707 - 16,242,970	UniSTS
Cytogenetic Map	X	q13	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
8	7	46	107	35	34	8	13	8	6	137	80	87	35	35	26

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_021670	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AJ132407	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474078	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000003989 ⟹ ENSRNOP00000003989

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	X	16,169,123 - 16,174,187 (+)	Ensembl
Rnor_6.0 Ensembl	X	17,016,778 - 17,023,418 (+)	Ensembl

RefSeq Acc Id:

NM_021670 ⟹ NP_067702

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	18,840,943 - 18,846,006 (+)	NCBI
mRatBN7.2	X	16,169,123 - 16,174,187 (+)	NCBI
Rnor_6.0	X	17,016,831 - 17,021,894 (+)	NCBI
Rnor_5.0	X	17,797,360 - 17,802,423 (+)	NCBI
RGSC_v3.4	X	29,003,933 - 29,008,996 (-)	RGD
Celera	X	16,238,220 - 16,243,279 (+)	RGD

Sequence:

show sequence

GGGAAGGCTATGCTGCCTTGTCCCACTTGCTGGTTCTGTTTGTTTTCATGCCAAAAAGCCTAGT
CAGGAGACTTGCTTTGGCCCAGAAGATTCTCCCACAGGAAGCAAGATAGGGTCTGCCAGCCGGC
TTTTCTTTTTATTTCTTGCCCCGTCTTTGCTATTTGTTAAACCAGGATGTGGAAGAGGTCAGAC
TGATGTTCTTTGGACTTGGTTAGGAATCTGTTGACAAGCACCAAGCTTTGCAAGATGGCCCTTC
TCACAATTCTTAGAATTCTTTTGTGGGGAATGGTGCTTTTTATGGAACACAAGGTCCAAATGGC
AAAGGTAGAGTGGCCCTCCACTACCCTCCTTGCTGAAAACCCTACATTGCCCTCGAGTTTGGAT
CTGGCCAAAGAAGCCCCTGGCAAGGAGATGAAGCAGTGGCCCCAAGGATATCCCCTGAGGTACA
TGCTGAAGTTATACCAGCGTTCGGCTGACCCACATGGGCACCCGAGGGAGAACCGCACGATTGG
AGCTAAAATGGTGAGGCTGATAAAGCCGTCAGCCAGTGCAATGAGGCTTCTCAGAGGTCCTTGG
CATATACAGACCCTGGACTTTCCTCTAGCATCAAACGAGGTAGCATACCAACTAATCAGAGCCA
CTGTGGTCTACCGCCATCAACTTCATCTAGTTCATTACCATCTCTCCTGCCATGTGGAACCTTG
GGTCCCTAAATGTCGAACCAAGCACTTTCCATCTAAATCGGGTTCTGCAAAGCCTTCTTCTGTG
TCTAAAGCCTGGAGAGAGATGAATATTACCCACTGTATTCAGCAGAAGCTCTGGAATCGCAAGG
GACGGAGAGTCCTTCGCCTCCGCTTCATGTGTCAGCAGCAAAAAGGCAATGAGACTCTTGAGCT
CCGGTGGCATGGCATGACCTCCTTGGATGTTGCCTTCTTGCTACTCTATTTCGATGACACTGAT
GAGAGTGCTCAGGCTAAACTTCTTGCAAGAGGTCAAGAGGAGTTAACTGATAGGGAATCTCCTT
TTCTTATGCGGAGTGTCCGGCAAACATGCAGCATAGCATCTGATGTCCCTTGTCCTTCTCAGGA
ACAGGATAGGTCTGTAAATAACCAGTGTTCCCTCCATCCTTACAAGGTCAGCTTCCATCAATTG
GGCTGGGATCACTGGATCATTGCTCCCCGTCTCTATACCCCAAATTACTGTAAAGGAATCTGTA
CTGGAGTATTACCCTATGGTCTAAATTCACCCAACCATGCCATCATACAGAGCCTTGTCAATGA
ACTAGTGAATCGCAGTGTGCCTCAGCTTTCCTGTGTCCCTTATAAGTTTCTTCCTATGAGTATC
CTTCTGATTGAGGCAAATGGGAGTATCTTGTACAAGGAGTATGAGGGTATGATTGCTCAGTCCT
GCACATGTAGATAACAGTGAACTTGTAGCTAGC

hide sequence

Protein Sequences


Protein RefSeqs	NP_067702	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAB41039	(Get FASTA)	NCBI Sequence Viewer
	EDL83870	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000003989.1

RefSeq Acc Id:	NP_067702 ⟸ NM_021670
- Peptide Label:	precursor
- UniProtKB:	E9PTU9 (UniProtKB/TrEMBL), Q9WUW1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MALLTILRILLWGMVLFMEHKVQMAKVEWPSTTLLAENPTLPSSLDLAKEAPGKEMKQWPQGYP LRYMLKLYQRSADPHGHPRENRTIGAKMVRLIKPSASAMRLLRGPWHIQTLDFPLASNEVAYQL IRATVVYRHQLHLVHYHLSCHVEPWVPKCRTKHFPSKSGSAKPSSVSKAWREMNITHCIQQKLW NRKGRRVLRLRFMCQQQKGNETLELRWHGMTSLDVAFLLLYFDDTDESAQAKLLARGQEELTDR ESPFLMRSVRQTCSIASDVPCPSQEQDRSVNNQCSLHPYKVSFHQLGWDHWIIAPRLYTPNYCK GICTGVLPYGLNSPNHAIIQSLVNELVNRSVPQLSCVPYKFLPMSILLIEANGSILYKEYEGMI AQSCTCR hide sequence

Ensembl Acc Id:

ENSRNOP00000003989 ⟸ ENSRNOT00000003989

Protein Domains

TGF-beta family profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-E9PTU9-F1-model_v2	AlphaFold	E9PTU9	1-391	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:70990	AgrOrtholog
BioCyc Gene	G2FUF-2870	BioCyc
Ensembl Genes	ENSRNOG00000002984	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000003989.4	UniProtKB/TrEMBL
Gene3D-CATH	2.10.90.10	UniProtKB/TrEMBL
InterPro	Cystine-knot_cytokine	UniProtKB/TrEMBL
	TGF-b_C	UniProtKB/TrEMBL
	TGF-beta-rel	UniProtKB/TrEMBL
	TGFb_CS	UniProtKB/TrEMBL
KEGG Report	rno:59302	UniProtKB/TrEMBL
NCBI Gene	59302	ENTREZGENE
PANTHER	PTHR11848:SF22	UniProtKB/TrEMBL
	TGFbeta	UniProtKB/TrEMBL
Pfam	TGF_beta	UniProtKB/TrEMBL
PhenoGen	Bmp15	PhenoGen
PRINTS	INHIBINA	UniProtKB/TrEMBL
PROSITE	TGF_BETA_1	UniProtKB/TrEMBL
	TGF_BETA_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000002984	RatGTEx
SMART	TGFB	UniProtKB/TrEMBL
Superfamily-SCOP	SSF57501	UniProtKB/TrEMBL
UniProt	A6KPC2_RAT	UniProtKB/TrEMBL
	E9PTU9	ENTREZGENE, UniProtKB/TrEMBL
	Q9WUW1	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-07-09	Bmp15	bone morphogenetic protein 15			Symbol and Name updated to reflect Human and Mouse nomenclature	70877	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in ovaries,granulosa cells and pituitary	628419
gene_process	may have a crucial role in regulating female reproduction; may play a physiological role in monotropic increase in FSH secretion by pituitary during estrous cycles	628419
gene_process	may be a potent stimulator of granulosa cell proliferation; along with kit ligand, forms a negative feedback loop to regulate granuosa cell growth	628419
gene_process	regulates functions of granulosa cells; also part of an autocrine control mechanism active in female fertility	628419

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM