Cpn1 (carboxypeptidase N subunit 1)

Advanced Search (OLGA)

Gene: Cpn1 (carboxypeptidase N subunit 1) Rattus norvegicus

Analyze

Symbol:

Cpn1

Name:

carboxypeptidase N subunit 1

RGD ID:

70931

Description:

Enables carboxypeptidase activity. Involved in bradykinin catabolic process; protein catabolic process; and response to glucocorticoid. Located in extracellular space. Human ortholog(s) of this gene implicated in carboxypeptidase N deficiency. Orthologous to human CPN1 (carboxypeptidase N subunit 1); PARTICIPATES IN kallikrein-kinin cascade pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

carboxypeptidase N; carboxypeptidase N catalytic chain; carboxypeptidase N catalytic chain-like; carboxypeptidase N small subunit; carboxypeptidase N, polypeptide 1; carboxypeptidase N, polypeptide 1, 50kD; Cpn; LOC100361985; MGC108636

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CPN1 (carboxypeptidase N subunit 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Cpn1 (carboxypeptidase N, polypeptide 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cpn1 (carboxypeptidase N subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CPN1 (carboxypeptidase N subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CPN1 (carboxypeptidase N subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cpn1 (carboxypeptidase N subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CPN1 (carboxypeptidase N subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CPN1 (carboxypeptidase N subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cpn1 (carboxypeptidase N subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Cpn1 (carboxypeptidase N subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ZNF652 (zinc finger protein 652)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CPN1 (carboxypeptidase N subunit 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cpn1 (carboxypeptidase N, polypeptide 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cpn1 (carboxypeptidase N, polypeptide 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	egl-21	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cpd-2	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	cpn1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cpn1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Candidate Gene For:

Rf1

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	252,793,786 - 252,822,675 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	252,793,423 - 252,822,664 (-)	Ensembl				GRCr8
mRatBN7.2	1	242,844,575 - 242,873,465 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	242,844,212 - 242,873,465 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	250,994,882 - 251,023,886 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	257,691,758 - 257,720,626 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	250,345,029 - 250,374,038 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	263,733,887 - 263,762,758 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	263,733,519 - 263,762,785 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	271,179,096 - 271,207,752 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	1	238,661,460 - 238,690,684 (-)	NCBI		Celera
RGSC_v3.1	1	249,503,283 - 249,516,546	NCBI
Cytogenetic Map	1	q54	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

carboxypeptidase N deficiency (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

alpha-hexachlorocyclohexane (EXP)

amiodarone (EXP)

ammonium chloride (EXP)

Benoxacor (ISO)

benzbromarone (EXP)

benzo[a]pyrene (ISO)

Benzo[ghi]perylene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

cadmium atom (ISO)

cantharidin (ISO)

carbonyl sulfide (EXP)

chlorpyrifos (ISO)

ciguatoxin CTX1B (ISO)

clofibrate (EXP)

clozapine (EXP)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dexamethasone (EXP)

drometrizole (ISO)

epoxiconazole (ISO)

flutamide (EXP)

genistein (ISO)

haloperidol (EXP)

hydrazine (ISO)

L-ethionine (EXP)

methapyrilene (EXP)

methidathion (ISO)

methotrexate (ISO)

N-ethyl-N-nitrosourea (ISO)

N-Nitrosopyrrolidine (ISO)

naphthalene (ISO)

nickel atom (ISO)

nitrofen (EXP)

O-methyleugenol (ISO)

okadaic acid (ISO)

omeprazole (EXP)

paracetamol (EXP,ISO)

paraquat (EXP)

pentanal (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

pirinixic acid (EXP,ISO)

propanal (ISO)

propiconazole (ISO)

quercetin (ISO)

resveratrol (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

succimer (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

trichloroethene (EXP)

triptonide (ISO)

troglitazone (ISO)

valproic acid (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

bradykinin catabolic process (IMP)

peptide metabolic process (IBA)

protein catabolic process (IDA)

protein processing (IBA)

proteolysis (IEA)

response to glucocorticoid (IDA)

Cellular Component

extracellular region (IEA)

extracellular space (IBA,IDA)

Molecular Function

carboxypeptidase activity (IDA,IEA,IMP,ISO)

hydrolase activity (IEA)

metal ion binding (IEA)

metallocarboxypeptidase activity (IBA,IEA)

metallopeptidase activity (IEA)

peptidase activity (IEA)

protein binding (ISO)

zinc ion binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

kallikrein-kinin cascade pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Pathways of bradykinin degradation in blood and plasma of normotensive and hypertensive rats.	Dendorfer A, etal., Am J Physiol Heart Circ Physiol. 2001 May;280(5):H2182-8.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Molecular cloning and partial characterization of rat procarboxypeptidase R and carboxypeptidase N.	Kato T, etal., Microbiol Immunol 2000;44(8):719-28.
5.	Molecular cloning and partial characterization of rat procarboxypeptidase R and carboxypeptidase N.	Kato T, etal., Microbiol Immunol 2000;44(8):719-28.
6.	Gene Data Set	MGD Curation, June 12, 2002
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	The kallikrein-kinin system: current and future pharmacological targets.	Moreau ME, etal., J Pharmacol Sci. 2005 Sep;99(1):6-38.
9.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
11.	Dexamethasone induced alterations in the levels of proteases involved in blood pressure homeostasis and blood coagulation in rats.	Rajashree S and Puvanakrishnan R, Mol Cell Biochem. 1999 Jul;197(1-2):203-8.
12.	GOA pipeline	RGD automated data pipeline
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10878383	PMID:12477932	PMID:15489334

Genomics

Comparative Map Data

Cpn1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	252,793,786 - 252,822,675 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	252,793,423 - 252,822,664 (-)	Ensembl				GRCr8
mRatBN7.2	1	242,844,575 - 242,873,465 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	242,844,212 - 242,873,465 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	250,994,882 - 251,023,886 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	257,691,758 - 257,720,626 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	250,345,029 - 250,374,038 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	263,733,887 - 263,762,758 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	263,733,519 - 263,762,785 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	271,179,096 - 271,207,752 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	1	238,661,460 - 238,690,684 (-)	NCBI		Celera
RGSC_v3.1	1	249,503,283 - 249,516,546	NCBI
Cytogenetic Map	1	q54	NCBI

CPN1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	100,042,193 - 100,081,869 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	100,042,193 - 100,081,907 (-)	Ensembl			hg38	GRCh38
GRCh37	10	101,801,950 - 101,841,626 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	101,792,055 - 101,831,632 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	10	101,792,061 - 101,831,584	NCBI
Celera	10	95,540,028 - 95,579,610 (-)	NCBI		Celera
Cytogenetic Map	10	q24.2	NCBI
HuRef	10	95,429,710 - 95,469,676 (-)	NCBI		HuRef
CHM1_1	10	102,085,365 - 102,124,940 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	10	100,925,921 - 100,965,601 (-)	NCBI		T2T-CHM13v2.0

Cpn1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	43,944,746 - 43,974,990 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	43,944,746 - 43,974,995 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	19	43,956,307 - 43,986,551 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	43,956,307 - 43,986,556 (-)	Ensembl			mm10	GRCm38
MGSCv37	19	44,030,797 - 44,061,010 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	19	44,009,618 - 44,039,831 (-)	NCBI		MGSCv36	mm8
Celera	19	44,739,811 - 44,769,775 (-)	NCBI		Celera
Cytogenetic Map	19	C3	NCBI
cM Map	19	36.68	NCBI

Cpn1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955507	5,926,508 - 5,952,559 (-)	Ensembl
ChiLan1.0	NW_004955507	5,926,508 - 5,952,515 (-)	NCBI	ChiLan1.0	ChiLan1.0

CPN1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	111,930,388 - 111,972,811 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	111,935,709 - 111,978,132 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	96,647,273 - 96,689,346 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	100,130,688 - 100,171,687 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	100,130,688 - 100,171,687 (-)	Ensembl			panPan2	panpan1.1

CPN1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	28	12,875,737 - 12,902,514 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	28	12,875,249 - 12,902,264 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	28	13,059,343 - 13,092,971 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	28	13,344,541 - 13,371,085 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	28	13,344,661 - 13,370,797 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	28	12,891,401 - 12,925,017 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	28	12,929,454 - 12,963,113 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	28	13,063,739 - 13,097,391 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Cpn1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	34,105,694 - 34,134,200 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936636	145,024 - 172,876 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936636	145,148 - 172,865 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CPN1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	111,182,793 - 111,227,198 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	111,182,790 - 111,213,378 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	120,628,015 - 120,658,886 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CPN1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	93,077,181 - 93,121,339 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	93,077,127 - 93,121,059 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666048	54,083,277 - 54,121,510 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cpn1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624737	11,848,921 - 11,880,961 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624737	11,851,502 - 11,880,815 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Cpn1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	43,487,796 - 43,515,647 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Cpn1
219 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	62
Count of miRNA genes:	48
Interacting mature miRNAs:	55
Transcripts:	ENSRNOT00000018221
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	160111531	262090437	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	266453731	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	186658830	266453731	Rat
2293674	Bss39	Bone structure and strength QTL 39	7.1	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	1	210980612	255980612	Rat
61327	Eae7	Experimental allergic encephalomyelitis QTL 7	5.6		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	226175591	270518180	Rat
1578775	Iddm21	Insulin dependent diabetes mellitus QTL 21	4.13		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	245782829	270518180	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	205233991	267096252	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	218829748	263829748	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	186658830	266453731	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	205233991	267096252	Rat
631837	Niddm35	Non-insulin dependent diabetes mellitus QTL 35		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	248619887	269633915	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	176288899	270518180	Rat
631836	Stl31	Serum triglyceride level QTL 31	4.64	5e-06	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	247133834	270518180	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	162548015	270518180	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	132966869	252856240	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	205233991	267096252	Rat
2293694	Bss38	Bone structure and strength QTL 38	7.05	0.0001	femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	1	210980612	255980612	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	152919152	268496042	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	160111531	262090437	Rat
1300108	Rf8	Renal function QTL 8	3.75		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	1	237995023	269633915	Rat
734767	Niddm57	Non-insulin dependent diabetes mellitus QTL 57			body mass (VT:0001259)	body weight (CMO:0000012)	1	233480549	270108840	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	200449456	256003563	Rat
631215	Stl8	Serum triglyceride level QTL 8	9.27	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	1	234540191	270518180	Rat
631843	Bw116	Body weight QTL 116	4.1	0.016	abdominal adipose amount (VT:1000220)	abdominal fat pad weight (CMO:0000088)	1	233480549	270108840	Rat
731175	Uae20	Urinary albumin excretion QTL 20	3.5	0.0018	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	207163993	269633915	Rat
2300175	Bmd40	Bone mineral density QTL 40	15.4	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	1	210980612	255980612	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
724538	Kidm1	Kidney mass QTL 1	3.2		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	223134011	262090599	Rat
2293655	Bss36	Bone structure and strength QTL 36	10.66	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	210980612	255980612	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	160111426	262090599	Rat
2314011	Gluco56	Glucose level QTL 56			blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	209203273	254203273	Rat
734769	Niddm58	Non-insulin dependent diabetes mellitus QTL 58			body mass (VT:0001259)	body weight (CMO:0000012)	1	225108840	270108840	Rat
724533	Rf51	Renal function QTL 51	5.3	0.0002	kidney plasma flow trait (VT:0005524)	renal plasma flow (CMO:0001914)	1	228180370	266453608	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	154961463	266453731	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	208479811	269633915	Rat
70211	Niddm24	Non-insulin dependent diabetes mellitus QTL 24	3.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	224633915	269633915	Rat
724552	Glom2	Glomerulus QTL 2	3.3	0.0001	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	1	232312773	270518180	Rat
2316896	Gluco57	Glucose level QTL 57	7.2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	238398865	255849249	Rat
1358916	Kidm22	Kidney mass QTL 22	3.32		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	212738576	257738576	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	194786607	262083703	Rat
2292218	Kidm35	Kidney mass QTL 35			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	208798288	253798288	Rat
61400	Niddm1	Non-insulin dependent diabetes mellitus QTL 1	11		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	228180243	255849249	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
2293700	Bmd27	Bone mineral density QTL 27	6.6	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	210980612	255980612	Rat
2293701	Bmd34	Bone mineral density QTL 34	8.3	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	1	210980612	255980612	Rat
7387289	Uae45	Urinary albumin excretion QTL 45	2.86	0.0021	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	233204160	270518180	Rat
1581544	Rf52	Renal function QTL 52		0.05	urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	1	241569529	269633915	Rat
1600363	Hc6	Hypercalciuria QTL 6	2.7		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	210980612	255980612	Rat
631536	Lnnr2	Liver neoplastic nodule remodeling QTL 2	2.9	0.0005	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	1	243953669	270518180	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	185857683	270518180	Rat
2302040	Pia35	Pristane induced arthritis QTL 35	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	226175591	270518180	Rat
631669	Iddm9	Insulin dependent diabetes mellitus QTL 9	2.8	0.039	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	233349180	270518180	Rat
7394701	Uae46	Urinary albumin excretion QTL 46	3.6	0.0056	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	210980612	255980612	Rat
1598821	Rf55	Renal function QTL 55	6.3		renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	228174566	270518180	Rat

Markers in Region

RH133012

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	242,844,614 - 242,844,801 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	263,733,927 - 263,734,113	NCBI	Rnor6.0
Rnor_5.0	1	271,179,136 - 271,179,322	UniSTS	Rnor5.0
Celera	1	238,661,500 - 238,661,686	UniSTS
RH 3.4 Map	1	1619.6	UniSTS
Cytogenetic Map	1	q54	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
16	11	38	116	91	90	59	25	59	6	249	86	96	80	90	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053526	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB042599	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC096315	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088124	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473986	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218535	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219519	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000018221 ⟹ ENSRNOP00000018221

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	252,793,423 - 252,822,664 (-)	Ensembl
mRatBN7.2 Ensembl	1	242,844,212 - 242,873,454 (-)	Ensembl
Rnor_6.0 Ensembl	1	263,733,519 - 263,762,785 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097024 ⟹ ENSRNOP00000081878

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	242,846,991 - 242,873,465 (-)	Ensembl

RefSeq Acc Id:

NM_053526 ⟹ NP_445978

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	252,793,786 - 252,822,675 (-)	NCBI
mRatBN7.2	1	242,844,575 - 242,873,465 (-)	NCBI
Rnor_6.0	1	263,733,887 - 263,762,758 (-)	NCBI
Rnor_5.0	1	271,179,096 - 271,207,752 (-)	NCBI
Celera	1	238,661,460 - 238,690,684 (-)	RGD

Sequence:

show sequence

GGGGAAGGGAAATGAGTCCGGAGGGCAACGTGGCTATCCCGGGGCCACAGAAATAATTCCCAGT
GTAGCAGAGGCGGGTCCCCAGCCTCCTGCAGGTGCGGCGGGTGCGAGGCGGCTACTCTGGATCC
CAACAGGCAAAGGATTGCTTGGAGAGAGCGGGAAGGCACATTTTAGAGCCGCTTAGAAGCTCCT
CGAGATGCCAGACCTGCCCTCAGCCTTCCTGCCCCTCCTCCTCCTCTCCAAGTTTGTTACCCCG
GTGACCTTTCGTCACCACCGCTACGACGACCTCGTGCGGACGCTGTACAAGGTGCACAACCAAT
GCCCGGACATCACGCGGCTCTACAACATCGGGCGCAGCGTGAAGGGGAGGTACCTCTACGTGCT
GGAGTTTAGCGACTATCCTGGGACCCATGAACCCTTGGAACCGGAAGTCAAGTACGTGGGGAAC
ATGCACGGGAACGAGGTGCTGGGCCGCGAACTGCTGCTGCAGCTGTCGGAATTCCTCTGCGAGG
AGTTCCGGAACCGGAACCAGCGCATCCTGCGCCTCATCCAGGACACCCGCATTCACATCCTTCC
ATCCATGAACCCTGACGGCTACGAGGTGGCTGCTGCCCAGGGCCCAAACACGTCTGGGTATCTG
GTTGGTAGGAACAATGCAAATGGGGTGGACCTGAACCGAAACTTCCCGGATCTCAACACCTATT
TCTACTACAATTCGAAGTATGGCGGCCCCAACCACCACCTGCCCCTCCCTGACAACTGGAAAAG
TCAGGTGGAACCAGAGACCCGGGCAGTGATCCAGTGGATTCGATCCTTAAACTTCGTTCTCTCA
GCCAATATGCACGGCGGGGCTGTGGTGGCCAATTACCCATATGACAAGTCACTGGAACACAGGT
TCCGAAGTCCCCATCGCACCTCCAATTCCCCCACACCGGATGACGAGCTCTTCCAGACGCTGGC
CAAGGTCTACTCCTACGCACATGGATGGATGCACCAAGGTTGGAACTGTGGGGACTACTTTCCA
GACGGCATCACCAATGGGGCATCCTGGTATTCTCTAAGCAAGGGAATGCAAGACTTCAATTATC
TCCATACCAACTGCTTTGAGATCACCCTAGAGCTGAGTTGCAACAAGTTTCCCCGGCAAGAAGA
GCTGCAAAGGGAGTGGCTGGGTAACCGGGAAGCCTTAATCCAGTTCTTGGAACAGGTTCACCAG
GGCATCAAGGGAATGGTGCTTGACGAGAACTATAACAACCTCACAGGGGCTGTCATTTCCGTCA
CCGGCATCAACCACGATGTCACTTCAGGTGAACACGGGGATTATTTCCGGCTGCTGCTTCCAGG
TACTTACTCAGTCACTGCCAAGGCATCAGGGTATGAGCCCAAAACAGTGACTGTGACCGTGGGG
CCTGCGGGACCAACACTGGTTGACTTCCAGCTCAAGCGAAGCACGACTCAGGTGCACCCTGTGC
AGAAAGCTCCTGGCCGAGGACAGGGAAGCAGGGCAAAGCAGCCCCGGACATCCAGAAAGAAAGA
CCAGGCAGCAAAGCGGCACAGGGGCCCTGCATGAAGCCCAGCACCCAGGGCCACACACAGCGAG
GCTATCCCTGCTCTCAAACCCCCATGGCCACACTTCTCTTTTCTTATCTGGGACATATGTAGAC
GCAGGCACGTACCGAACAGTTCTGAGTGTTTCTGTCTGTCCCAGGATCAAGCCTTCCTTGGGCC
AGCATTAAAGGAGTCCGAACCTTCCAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_445978	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88124	(Get FASTA)	NCBI Sequence Viewer
	BAB18618	(Get FASTA)	NCBI Sequence Viewer
	EDL94268	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000018221
	ENSRNOP00000018221.6
GenBank Protein	Q9EQV8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_445978 ⟸ NM_053526
- Peptide Label:	precursor
- UniProtKB:	Q9EQV8 (UniProtKB/Swiss-Prot), A0A8I5ZTU6 (UniProtKB/TrEMBL), A6JHE4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPDLPSAFLPLLLLSKFVTPVTFRHHRYDDLVRTLYKVHNQCPDITRLYNIGRSVKGRYLYVLE FSDYPGTHEPLEPEVKYVGNMHGNEVLGRELLLQLSEFLCEEFRNRNQRILRLIQDTRIHILPS MNPDGYEVAAAQGPNTSGYLVGRNNANGVDLNRNFPDLNTYFYYNSKYGGPNHHLPLPDNWKSQ VEPETRAVIQWIRSLNFVLSANMHGGAVVANYPYDKSLEHRFRSPHRTSNSPTPDDELFQTLAK VYSYAHGWMHQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCNKFPRQEEL QREWLGNREALIQFLEQVHQGIKGMVLDENYNNLTGAVISVTGINHDVTSGEHGDYFRLLLPGT YSVTAKASGYEPKTVTVTVGPAGPTLVDFQLKRSTTQVHPVQKAPGRGQGSRAKQPRTSRKKDQ AAKRHRGPA hide sequence

Ensembl Acc Id:

ENSRNOP00000018221 ⟸ ENSRNOT00000018221

Ensembl Acc Id:

ENSRNOP00000081878 ⟸ ENSRNOT00000097024

Protein Domains

Peptidase M14

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9EQV8-F1-model_v2	AlphaFold	Q9EQV8	1-457	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690931

Promoter ID:

EPDNEW_R1456

Type:

initiation region

Name:

Cpn1_1

Description:

carboxypeptidase N subunit 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	263,762,775 - 263,762,835	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:70931	AgrOrtholog
BioCyc Gene	G2FUF-55616	BioCyc
Ensembl Genes	ENSRNOG00000013439	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000018221	ENTREZGENE
	ENSRNOT00000018221.8	UniProtKB/Swiss-Prot
Gene3D-CATH	Carboxypeptidase-like, regulatory domain	UniProtKB/Swiss-Prot
	Zn peptidases	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7326031	IMAGE-MGC_LOAD
InterPro	CarboxyPept-like_regulatory	UniProtKB/Swiss-Prot
	Peptidase_M14	UniProtKB/Swiss-Prot
	Peptidase_M14_domain	UniProtKB/Swiss-Prot
KEGG Report	rno:365466	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:108636	IMAGE-MGC_LOAD
NCBI Gene	Cpn1	ENTREZGENE
PANTHER	PROTEASE M14 CARBOXYPEPTIDASE	UniProtKB/Swiss-Prot
	PTHR11532:SF80	UniProtKB/Swiss-Prot
Pfam	CarboxypepD_reg	UniProtKB/Swiss-Prot
	Peptidase_M14	UniProtKB/Swiss-Prot
PhenoGen	Cpn1	PhenoGen
PRINTS	CRBOXYPTASEA	UniProtKB/Swiss-Prot
PROSITE	CARBOXYPEPT_ZN_1	UniProtKB/Swiss-Prot
	CARBOXYPEPT_ZN_2	UniProtKB/Swiss-Prot
	PEPTIDASE_M14	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000013439	RatGTEx
SMART	Zn_pept	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF49464	UniProtKB/Swiss-Prot
	Zn-dependent exopeptidases	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZTU6	ENTREZGENE
	A6JHE4	ENTREZGENE, UniProtKB/TrEMBL
	CBPN_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-23	Cpn1	carboxypeptidase N subunit 1	Cpn1	carboxypeptidase N, polypeptide 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-07-29	Cpn1	carboxypeptidase N, polypeptide 1	LOC100361985	carboxypeptidase N, polypeptide 1	Data merged from RGD:2319095	737654	PROVISIONAL
2010-05-05	LOC100361985	carboxypeptidase N, polypeptide 1			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-02-18	Cpn1	carboxypeptidase N, polypeptide 1	Cpn1	carboxypeptidase N, polypeptide 1, 50kD	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-07-09	Cpn1	carboxypeptidase N, polypeptide 1, 50kD			Symbol and Name updated to reflect Human and Mouse nomenclature	70877	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	stable active form is localized to plasma	632519
gene_regulation	expression is upregulated under inflammatory conditions	632519

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations