Advanced Search (OLGA)

Gene: Necab1 (N-terminal EF-hand calcium binding protein 1) Rattus norvegicus

Analyze

Symbol:

Necab1

Name:

N-terminal EF-hand calcium binding protein 1

RGD ID:

708548

Description:

Predicted to enable identical protein binding activity. Predicted to be involved in regulation of amyloid precursor protein biosynthetic process. Predicted to act upstream of or within blastocyst hatching. Predicted to be active in cytoplasm. Orthologous to human NECAB1 (N-terminal EF-hand calcium binding protein 1); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

EF hand calcium binding protein 1; EF-hand calcium-binding protein 1; Efcbp1; N-terminal EF-hand calcium-binding protein 1; neuronal Ca(2+)-binding protein 1; neuronal calcium-binding protein 1; Stip-1; synaptotagmin interacting protein 1; synaptotagmin-interacting protein 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	33,155,078 - 33,375,707 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	33,153,975 - 33,375,707 (-)	Ensembl				GRCr8
mRatBN7.2	5	28,357,859 - 28,578,642 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	28,330,206 - 28,357,152 (+)	Ensembl				mRatBN7.2
mRatBN7.2 Ensembl	5	28,357,859 - 28,578,642 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	30,518,914 - 30,720,223 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	32,111,591 - 32,312,896 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	32,071,758 - 32,273,057 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	28,507,596 - 28,737,556 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	28,504,558 - 28,737,719 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	33,184,793 - 33,414,358 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	29,427,273 - 29,664,037 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	27,607,138 - 27,808,811 (-)	NCBI		Celera
RGSC_v3.1	5	29,427,272 - 29,664,037 (-)	NCBI
Cytogenetic Map	5	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

(1->4)-beta-D-glucan (ISO)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4,4'-trichlorobiphenyl (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

andrographolide (ISO)

aristolochic acid A (ISO)

astemizole (EXP)

atrazine (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-naphthoflavone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (EXP,ISO)

cadmium dichloride (EXP)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlordecone (ISO)

cyclosporin A (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

entinostat (ISO)

ethanol (ISO)

fenvalerate (EXP)

flavonoids (EXP)

folic acid (ISO)

fulvestrant (ISO)

inulin (ISO)

Licochalcone B (ISO)

lipopolysaccharide (ISO)

methamphetamine (EXP)

methoxychlor (EXP)

microcystin-LR (EXP)

O-methyleugenol (ISO)

okadaic acid (ISO)

PCB138 (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

poly(I:C) (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

tetraphene (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

zalcitabine (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

blastocyst hatching (ISO)

regulation of amyloid precursor protein biosynthetic process (IBA)

Cellular Component

cilium (ISO)

cytoplasm (IBA,IEA)

nucleoplasm (ISO)

Molecular Function

calcium ion binding (IEA)

identical protein binding (ISO)

metal ion binding (IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	NECABs: a family of neuronal Ca(2+)-binding proteins with an unusual domain structure and a restricted expression pattern.	Sugita S, etal., Neuroscience 2002;112(1):51-63.

Additional References at PubMed

PMID:27869233

Genomics

Comparative Map Data

Necab1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	33,155,078 - 33,375,707 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	33,153,975 - 33,375,707 (-)	Ensembl				GRCr8
mRatBN7.2	5	28,357,859 - 28,578,642 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	28,330,206 - 28,357,152 (+)	Ensembl				mRatBN7.2
mRatBN7.2 Ensembl	5	28,357,859 - 28,578,642 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	30,518,914 - 30,720,223 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	32,111,591 - 32,312,896 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	32,071,758 - 32,273,057 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	28,507,596 - 28,737,556 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	28,504,558 - 28,737,719 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	33,184,793 - 33,414,358 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	29,427,273 - 29,664,037 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	27,607,138 - 27,808,811 (-)	NCBI		Celera
RGSC_v3.1	5	29,427,272 - 29,664,037 (-)	NCBI
Cytogenetic Map	5	q13	NCBI

NECAB1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	90,791,775 - 90,959,393 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	90,791,741 - 90,959,393 (+)	Ensembl			hg38	GRCh38
GRCh37	8	91,804,003 - 91,971,621 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	91,872,954 - 92,040,806 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	8	91,872,953 - 92,040,806	NCBI
Celera	8	87,998,620 - 88,166,361 (+)	NCBI		Celera
Cytogenetic Map	8	q21.3	NCBI
HuRef	8	87,013,523 - 87,181,552 (+)	NCBI		HuRef
CHM1_1	8	91,844,508 - 92,012,293 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	8	91,916,601 - 92,084,316 (+)	NCBI		T2T-CHM13v2.0

Necab1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	14,952,245 - 15,149,804 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	14,952,245 - 15,149,794 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	14,952,245 - 15,149,804 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	14,952,245 - 15,149,794 (-)	Ensembl			mm10	GRCm38
MGSCv37	4	14,879,392 - 15,076,278 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	14,879,395 - 15,076,261 (-)	NCBI		MGSCv36	mm8
Celera	4	14,753,853 - 14,952,324 (-)	NCBI		Celera
Cytogenetic Map	4	A2	NCBI
cM Map	4	6.45	NCBI

Necab1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955417	7,573,861 - 7,737,913 (+)	Ensembl
ChiLan1.0	NW_004955417	7,573,861 - 7,737,920 (+)	NCBI	ChiLan1.0	ChiLan1.0

NECAB1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	108,160,887 - 108,330,181 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	83,699,385 - 83,868,688 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	87,453,523 - 87,622,800 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	89,405,495 - 89,573,788 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2

NECAB1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	29	36,154,555 - 36,332,111 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	29	36,154,510 - 36,329,460 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	29	36,299,409 - 36,484,455 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	29	36,348,024 - 36,533,389 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	29	36,348,046 - 36,533,385 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	29	36,346,899 - 36,553,590 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	29	36,349,439 - 36,535,346 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	29	36,788,023 - 36,973,627 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Necab1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	43,201,181 - 43,352,967 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936544	4,439,900 - 4,583,885 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936544	4,439,739 - 4,589,060 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NECAB1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	45,982,106 - 46,239,654 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	45,981,777 - 46,239,673 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	49,754,887 - 49,826,195 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NECAB1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	85,851,899 - 86,027,993 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666039	54,835,703 - 55,012,088 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Necab1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624744	1,021,089 - 1,211,694 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624744	1,021,362 - 1,211,739 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Necab1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	128,605,680 - 128,793,707 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Necab1
1561 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	37
Count of miRNA genes:	35
Interacting mature miRNAs:	37
Transcripts:	ENSRNOT00000009718
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2293666	Bmd38	Bone mineral density QTL 38	4.4		femur size trait (VT:1000369)	femoral neck cortical cross-sectional area (CMO:0001702)	5	13731153	43590997	Rat
1578776	Stresp18	Stress response QTL 18	2.9		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	5	32751649	77751649	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	6922282	81330203	Rat
6903306	Scl35	Serum cholesterol QTL 35	2.6	0.0073	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33311673	78311673	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	23671493	79046465	Rat
1300117	Hrtrt8	Heart rate QTL 8	3.49		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	8627230	52665523	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	17576633	62576633	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	14606078	59606078	Rat
1578774	Tcas8	Tongue tumor susceptibility QTL 8	3.47		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	15707451	60707451	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	10019064	91770353	Rat
2312562	Pur18	Proteinuria QTL 18	2.6	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	5	6922282	37468560	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	7065535	74335773	Rat
6903292	Stl28	Serum triglyceride level QTL 28	2.6	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	5	33311673	78311673	Rat
1641903	Alcrsp3	Alcohol response QTL 3			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	17486080	62486080	Rat
1578767	Stresp17	Stress response QTL 17	4.3	0.01	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	5	32751649	77751649	Rat
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	10019064	87027358	Rat
8552954	Pigfal14	Plasma insulin-like growth factor 1 level QTL 14	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	26023211	71023211	Rat
2303577	Gluco47	Glucose level QTL 47	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	16520019	61520019	Rat
1549901	Neudeg2	Neurodegradation QTL 2	4	0	nervous system integrity trait (VT:0010566)	mononuclear cell count (CMO:0002119)	5	31130421	48841739	Rat
1641922	Alcrsp8	Alcohol response QTL 8			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	5	17486080	62486080	Rat
1600358	Mamtr5	Mammary tumor resistance QTL 5			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	23671493	68671493	Rat
2313085	Bss59	Bone structure and strength QTL 59	2.9	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	5	8627230	53627230	Rat

Markers in Region

D8Got25

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	28,493,998 - 28,494,213 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	28,651,323 - 28,651,537	NCBI	Rnor6.0
Rnor_5.0	5	33,327,771 - 33,327,985	UniSTS	Rnor5.0
RGSC_v3.4	5	29,576,836 - 29,577,051	RGD	RGSC3.4
RGSC_v3.4	5	29,576,837 - 29,577,051	UniSTS	RGSC3.4
Celera	5	27,724,449 - 27,724,654	UniSTS
RGSC_v3.1	5	29,576,837 - 29,577,051	RGD
RH 3.4 Map	5	158.91	RGD
RH 3.4 Map	5	158.91	UniSTS
Cytogenetic Map	5	q13	UniSTS

RH141013

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	28,473,660 - 28,473,859 (+)	MAPPER	mRatBN7.2
mRatBN7.2	6	27,884,774 - 27,884,972 (-)	MAPPER	mRatBN7.2
mRatBN7.2	6	27,884,774 - 27,884,972 (+)	MAPPER	mRatBN7.2
mRatBN7.2	5	28,473,660 - 28,473,859 (-)	MAPPER	mRatBN7.2
Rnor_6.0	5	28,629,109 - 28,629,306	NCBI	Rnor6.0
Rnor_6.0	6	28,969,993 - 28,970,190	NCBI	Rnor6.0
Rnor_5.0	5	33,306,053 - 33,306,250	UniSTS	Rnor5.0
Rnor_5.0	6	40,916,940 - 40,917,137	UniSTS	Rnor5.0
RGSC_v3.4	5	29,557,427 - 29,557,624	UniSTS	RGSC3.4
RGSC_v3.4	6	28,184,821 - 28,185,018	UniSTS	RGSC3.4
Celera	6	27,353,356 - 27,353,553	UniSTS
Celera	5	27,704,391 - 27,704,546	UniSTS
Cytogenetic Map	6	q14	UniSTS
Cytogenetic Map	5	q13	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
11	11	65	131	91	90	59	29	59	6	256	118	2	112	60	79	31	15	15

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022302	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF193755	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000009718 ⟹ ENSRNOP00000009718

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	33,127,410 - 33,153,523 (+)	Ensembl
mRatBN7.2 Ensembl	5	28,330,206 - 28,357,152 (+)	Ensembl
Rnor_6.0 Ensembl	5	28,504,558 - 28,737,719 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000115654 ⟹ ENSRNOP00000092906

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	33,158,060 - 33,375,707 (-)	Ensembl
mRatBN7.2 Ensembl	5	28,360,841 - 28,578,642 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000118373 ⟹ ENSRNOP00000088635

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	33,155,078 - 33,375,707 (-)	Ensembl
mRatBN7.2 Ensembl	5	28,357,859 - 28,578,642 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000127126 ⟹ ENSRNOP00000109723

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	33,155,078 - 33,375,707 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000128151 ⟹ ENSRNOP00000102748

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	33,153,975 - 33,375,707 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000138354 ⟹ ENSRNOP00000112074

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	33,127,410 - 33,174,768 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000139380 ⟹ ENSRNOP00000100605

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	33,127,410 - 33,152,912 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000162817 ⟹ ENSRNOP00000102971

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	33,126,632 - 33,152,912 (+)	Ensembl

RefSeq Acc Id:

NM_022302 ⟹ NP_071638

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	33,155,078 - 33,375,707 (-)	NCBI
mRatBN7.2	5	28,357,859 - 28,578,642 (-)	NCBI
Rnor_6.0	5	28,507,596 - 28,737,556 (-)	NCBI
Rnor_5.0	5	33,184,793 - 33,414,358 (-)	NCBI
RGSC_v3.4	5	29,427,273 - 29,664,037 (-)	RGD
Celera	5	27,607,138 - 27,808,811 (-)	RGD

Sequence:

show sequence

GAATTCCCAGGTCAGAACCGCTGCATCCCACCCGCCCAGTCAGTTCTCTGCCCGCCGGCGCCAG
GGTTGCTGAGGATGGAGGATTCCCGGGAGACCTCGCCGTCCTCCAACAACTCCTCAGAAGAGCT
CAGCTCTGCCCTGCAGCTGTCCAAGGGCATGTCCATCTTCCTCGACATACTGAGGAGAGCAGAC
AAAAATGACGATGGAAAATTGTCCTTTGAGGAATTTAAAGCGTATTTTGCAGATGGAGTTCTCA
GTGGAGAAGAACTACATGAGCTCTTCCACACCATTGACACACACAATACCAACAATCTTGACAC
AGAAGAACTATGTGAATATTTTTCTCAGCACTTGGGTGAATATGAGAATGTTCTGGCTGCACTT
GAAGACCTGAATCTCTCCATCCTGAAAGCAATGGGCAAGACAAAGAAAGACTACCAAGAAGCCT
CCAATTTGGAACAATTTGTCACTCGATTTTTGTTGAAGGAAACCTTGAATCAGTTGCAGTCTCT
TCAGAACTCTCTGGAATGTGCCATGGAAACTACTGAAGAGCAAACCCGTCAAGAAAGGCAAGGG
CCATCCAAGCCAGAAGTCTTGTCCATTCAATGGCCTGGAAAGCGATCCAGCCGCCGAGTCCAGA
GACACAACAGTTTCTCCCCCAACAGCCCACAGTTCAATGTCAGCAGCCCAGCATTGTTAGAAGA
AGACAATCAGTGGATGACCCAGATAAACAGACTCCAGAAATTAATTGATAGACTGGAAAAGAAG
GATCTGAAACTTGAACCCCTGGAAGAAGAAGTTATTGAAGAGAACACTAAACCTCACATCATGC
TTGTGCAGCGCCAGATGTCTGTGACAGAAGAGGATCTGGAAGAATTCCAGCTTGCTCTGAAGCA
CTACGTGGAGAGCGCTTCAGCACAAAGTGGGTGCCTGCGTATCTCTATACAGAAGCTTTCAAAT
GAATCTCGCTACATGATTTATGAGTTCTGGGAGAATAGCAGTGTGTGGAACCGCCACCTTCAGA
CAAATTACAGCAAGACGTTCCAAAGAAGCAACGTGGATTTCTTGGAAACTCCAGAGCTCACATC
TACTATGCTCGTTCCTGCTTCATGGTGGATCCTGAAAAACAATTAGATGCCCCACACAATGTCT
TCAAGTGTTCCAAGTGCCAAGTGGTCATTCCTATCTACAGCGGAAACCGGAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_071638	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG28411	(Get FASTA)	NCBI Sequence Viewer
	EDL98472	(Get FASTA)	NCBI Sequence Viewer
	EDL98473	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000088635
GenBank Protein	Q9ESB5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_071638 ⟸ NM_022302

- UniProtKB:

Q9ESB5 (UniProtKB/Swiss-Prot), A6IIA3 (UniProtKB/TrEMBL), A0A8I6A6X8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEDSRETSPSSNNSSEELSSALQLSKGMSIFLDILRRADKNDDGKLSFEEFKAYFADGVLSGEE
LHELFHTIDTHNTNNLDTEELCEYFSQHLGEYENVLAALEDLNLSILKAMGKTKKDYQEASNLE
QFVTRFLLKETLNQLQSLQNSLECAMETTEEQTRQERQGPSKPEVLSIQWPGKRSSRRVQRHNS
FSPNSPQFNVSSPALLEEDNQWMTQINRLQKLIDRLEKKDLKLEPLEEEVIEENTKPHIMLVQR
QMSVTEEDLEEFQLALKHYVESASAQSGCLRISIQKLSNESRYMIYEFWENSSVWNRHLQTNYS
KTFQRSNVDFLETPELTSTMLVPASWWILKNN

hide sequence

Ensembl Acc Id:

ENSRNOP00000009718 ⟸ ENSRNOT00000009718

Ensembl Acc Id:

ENSRNOP00000092906 ⟸ ENSRNOT00000115654

Ensembl Acc Id:

ENSRNOP00000088635 ⟸ ENSRNOT00000118373

Ensembl Acc Id:

ENSRNOP00000109723 ⟸ ENSRNOT00000127126

Ensembl Acc Id:

ENSRNOP00000102748 ⟸ ENSRNOT00000128151

Ensembl Acc Id:

ENSRNOP00000102971 ⟸ ENSRNOT00000162817

Ensembl Acc Id:

ENSRNOP00000112074 ⟸ ENSRNOT00000138354

Ensembl Acc Id:

ENSRNOP00000100605 ⟸ ENSRNOT00000139380

Protein Domains

ABM EF-hand

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9ESB5-F1-model_v2	AlphaFold	Q9ESB5	1-352	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:708548	AgrOrtholog
BioCyc Gene	G2FUF-41880	BioCyc
Ensembl Genes	ENSRNOG00000007256	Ensembl
	ENSRNOG00000066027	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000118373	ENTREZGENE
Gene3D-CATH	3.30.70.100	UniProtKB/Swiss-Prot
	EF-hand	UniProtKB/Swiss-Prot
InterPro	ABM_dom	UniProtKB/Swiss-Prot
	Dimeric_a/b-barrel	UniProtKB/Swiss-Prot
	EF-hand-dom_pair	UniProtKB/Swiss-Prot
	EF_Hand_1_Ca_BS	UniProtKB/Swiss-Prot
	EF_hand_dom	UniProtKB/Swiss-Prot
	NECAB1/2/3	UniProtKB/Swiss-Prot
KEGG Report	rno:64169	UniProtKB/Swiss-Prot
NCBI Gene	64169	ENTREZGENE
PANTHER	N-TERMINAL EF-HAND CALCIUM-BINDING PROTEIN 1	UniProtKB/Swiss-Prot
	PTHR12178	UniProtKB/Swiss-Prot
Pfam	ABM	UniProtKB/Swiss-Prot
PhenoGen	Necab1	PhenoGen
PROSITE	ABM	UniProtKB/Swiss-Prot
	EF_HAND_1	UniProtKB/Swiss-Prot
	EF_HAND_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000007256	RatGTEx
	ENSRNOG00000066027	RatGTEx
SMART	EFh	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47473	UniProtKB/Swiss-Prot
	SSF54909	UniProtKB/Swiss-Prot
UniProt	A0A8I6A6X8	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AES1_RAT	UniProtKB/TrEMBL
	A0ABK0L2F0_RAT	UniProtKB/TrEMBL
	A0ABK0LBP4_RAT	UniProtKB/TrEMBL
	A0ABK0LLF1_RAT	UniProtKB/TrEMBL
	A0ABK0LM87_RAT	UniProtKB/TrEMBL
	A0ABK0LYW8_RAT	UniProtKB/TrEMBL
	A6IIA3	ENTREZGENE, UniProtKB/TrEMBL
	NECA1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-25	Necab1	N-terminal EF-hand calcium binding protein 1	Efcbp1	EF hand calcium binding protein 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-12-14	Efcbp1	EF hand calcium binding protein 1			Symbol and Name status set to approved	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message