Symbol:
Slc1a5
Name:
solute carrier family 1 member 5
RGD ID:
708512
Description:
Enables L-amino acid transmembrane transporter activity; antiporter activity; and ligand-gated channel activity. Involved in carboxylic acid transport. Predicted to be located in basal plasma membrane; centriolar satellite; and ciliary basal body. Predicted to be active in plasma membrane. Orthologous to human SLC1A5 (solute carrier family 1 member 5); PARTICIPATES IN argininosuccinic aciduria pathway; carbamoyl phosphate synthetase I deficiency pathway; citrullinemia pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
ASC-like Na(+)-dependent neutral amino acid transporter ASCT2; Asct2; ATB(0); CAZ-associated structural protein; H4-ASCT2; H4-system ASC-like transporter; insulin-activated amino acid transporter; neutral amino acid transporter B(0); Slc1a7; sodium-dependent neutral amino acid transporter ASCT2; sodium-dependent neutral amino acid transporter type 2; solute carrier family 1 (neutral amino acid transporter), member 5; solute carrier family 1, member 7
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SLC1A5 (solute carrier family 1 member 5) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Slc1a5 (solute carrier family 1 (neutral amino acid transporter), member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Slc1a5 (solute carrier family 1 member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SLC1A5 (solute carrier family 1 member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SLC1A5 (solute carrier family 1 member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Slc1a5 (solute carrier family 1 member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SLC1A5 (solute carrier family 1 member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SLC1A5 (solute carrier family 1 member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Slc1a5 (solute carrier family 1 member 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
AP2B1 (adaptor related protein complex 2 subunit beta 1) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
SLC1A5 (solute carrier family 1 member 5)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Slc1a5 (solute carrier family 1 (neutral amino acid transporter), member 5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
slc1a5 (solute carrier family 1 member 5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
glt-4
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
Eaat1
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
slc1a5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 86,584,949 - 86,599,052 (+) NCBI GRCr8 mRatBN7.2 1 77,456,849 - 77,470,952 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 77,456,694 - 77,470,952 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 82,837,237 - 82,851,346 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 91,401,281 - 91,415,390 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 84,592,328 - 84,606,437 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 78,710,686 - 78,724,789 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 78,710,539 - 78,724,794 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 79,957,648 - 79,971,751 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 77,111,082 - 77,125,166 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 77,189,192 - 77,203,276 (+) NCBI Celera 1 71,941,916 - 71,956,019 (+) NCBI Celera Cytogenetic Map 1 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Slc1a5 Rat (-)-alpha-phellandrene decreases expression ISO SLC1A5 (Homo sapiens) 6480464 alpha phellandrene results in decreased expression of SLC1A5 mRNA CTD PMID:25075043 Slc1a5 Rat (S)-colchicine decreases expression ISO SLC1A5 (Homo sapiens) 6480464 Colchicine results in decreased expression of SLC1A5 mRNA CTD PMID:24211769 Slc1a5 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression ISO SLC1A5 (Homo sapiens) 6480464 o and p'-DDT results in increased expression of SLC1A5 mRNA CTD PMID:19371625 Slc1a5 Rat 1,2-dichloroethane decreases expression ISO Slc1a5 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of SLC1A5 mRNA CTD PMID:28960355 Slc1a5 Rat 1,2-dimethylhydrazine multiple interactions ISO Slc1a5 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SLC1A5 mRNA CTD PMID:22206623 Slc1a5 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of SLC1A5 mRNA CTD PMID:20551477 Slc1a5 Rat 17alpha-ethynylestradiol affects expression ISO SLC1A5 (Homo sapiens) 6480464 Ethinyl Estradiol affects the expression of SLC1A5 mRNA CTD PMID:20170705 Slc1a5 Rat 17alpha-ethynylestradiol increases expression ISO SLC1A5 (Homo sapiens) 6480464 Ethinyl Estradiol results in increased expression of SLC1A5 mRNA CTD PMID:18936297 Slc1a5 Rat 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of SLC1A5 mRNA CTD PMID:20170705 Slc1a5 Rat 17beta-estradiol increases expression ISO SLC1A5 (Homo sapiens) 6480464 Estradiol results in increased expression of SLC1A5 mRNA CTD PMID:23019147 more ... Slc1a5 Rat 17beta-estradiol decreases expression ISO SLC1A5 (Homo sapiens) 6480464 Estradiol results in decreased expression of SLC1A5 protein CTD PMID:33181973 Slc1a5 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of SLC1A5 mRNA and Estradiol results in increased expression of SLC1A5 protein CTD PMID:32145629 Slc1a5 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Slc1a5 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Slc1a5 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Slc1a5 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Slc1a5 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Slc1a5 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SLC1A5 mRNA CTD PMID:21570461 and PMID:26377647 Slc1a5 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SLC1A5 mRNA CTD PMID:33387578 and PMID:34747641 Slc1a5 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Slc1a5 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of SLC1A5 mRNA CTD PMID:26290441 and PMID:27562557 Slc1a5 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO SLC1A5 (Homo sapiens) 6480464 2 more ... CTD PMID:26705709 Slc1a5 Rat 2,6-dimethoxyphenol multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in increased expression of and affects the localization of SLC1A5 protein CTD PMID:38598786 Slc1a5 Rat 2-bromohexadecanoic acid multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of SLC1A5 protein] CTD PMID:38195004 Slc1a5 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Slc1a5 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Slc1a5 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS protein] results in increased expression of SLC1A5 mRNA CTD PMID:24848799 Slc1a5 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Slc1a5 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of SLC1A5 mRNA CTD PMID:18648102 Slc1a5 Rat 4,4'-sulfonyldiphenol affects expression ISO SLC1A5 (Homo sapiens) 6480464 bisphenol S affects the expression of SLC1A5 protein CTD PMID:31945527 Slc1a5 Rat 4,4'-sulfonyldiphenol increases expression ISO SLC1A5 (Homo sapiens) 6480464 bisphenol S results in increased expression of SLC1A5 protein CTD PMID:34186270 Slc1a5 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of SLC1A5 mRNA CTD PMID:31881176 Slc1a5 Rat acrylamide increases expression ISO SLC1A5 (Homo sapiens) 6480464 Acrylamide results in increased expression of SLC1A5 mRNA CTD PMID:32763439 Slc1a5 Rat adenine decreases expression ISO SLC1A5 (Homo sapiens) 6480464 Adenine results in decreased expression of SLC1A5 mRNA CTD PMID:24211769 Slc1a5 Rat aflatoxin B1 increases expression ISO SLC1A5 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of SLC1A5 mRNA CTD PMID:22100608 Slc1a5 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of SLC1A5 mRNA CTD PMID:25378103 Slc1a5 Rat alpha-phellandrene decreases expression ISO SLC1A5 (Homo sapiens) 6480464 alpha phellandrene results in decreased expression of SLC1A5 mRNA CTD PMID:25075043 Slc1a5 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SLC1A5 mRNA CTD PMID:16483693 Slc1a5 Rat arsane affects methylation ISO SLC1A5 (Homo sapiens) 6480464 Arsenic affects the methylation of SLC1A5 gene CTD PMID:25304211 Slc1a5 Rat arsane multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SLC1A5 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SLC1A5 mRNA CTD PMID:39836092 Slc1a5 Rat arsenic atom affects methylation ISO SLC1A5 (Homo sapiens) 6480464 Arsenic affects the methylation of SLC1A5 gene CTD PMID:25304211 Slc1a5 Rat arsenic atom multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SLC1A5 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SLC1A5 mRNA CTD PMID:39836092 Slc1a5 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of SLC1A5 gene CTD PMID:28931070 Slc1a5 Rat Bardoxolone methyl decreases glycosylation ISO SLC1A5 (Homo sapiens) 6480464 bardoxolone methyl results in decreased glycosylation of SLC1A5 protein CTD PMID:35929395 Slc1a5 Rat Bardoxolone methyl decreases expression ISO SLC1A5 (Homo sapiens) 6480464 bardoxolone methyl results in decreased expression of SLC1A5 protein CTD PMID:35929395 Slc1a5 Rat beauvericin multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [beauvericin co-treated with enniatins] results in increased expression of SLC1A5 protein CTD PMID:32407736 Slc1a5 Rat benzo[a]pyrene decreases expression ISO SLC1A5 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of SLC1A5 mRNA CTD PMID:20106945 and PMID:21632981 Slc1a5 Rat benzo[a]pyrene increases expression ISO SLC1A5 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of SLC1A5 mRNA CTD PMID:32234424 Slc1a5 Rat benzo[a]pyrene affects methylation ISO SLC1A5 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SLC1A5 promoter CTD PMID:27901495 Slc1a5 Rat benzo[a]pyrene decreases expression ISO Slc1a5 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of SLC1A5 mRNA CTD PMID:22228805 Slc1a5 Rat benzoates increases expression ISO SLC1A5 (Homo sapiens) 6480464 Benzoates analog results in increased expression of SLC1A5 mRNA CTD PMID:29472718 Slc1a5 Rat beta-naphthoflavone increases expression ISO SLC1A5 (Homo sapiens) 6480464 beta-Naphthoflavone results in increased expression of SLC1A5 mRNA CTD PMID:32858204 Slc1a5 Rat bis(2-chloroethyl) sulfide increases expression ISO Slc1a5 (Mus musculus) 6480464 Mustard Gas results in increased expression of SLC1A5 mRNA CTD PMID:15674843 Slc1a5 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Slc1a5 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of SLC1A5 mRNA CTD PMID:37364641 Slc1a5 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Slc1a5 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of SLC1A5 mRNA CTD PMID:34319233 Slc1a5 Rat bisphenol A affects expression ISO SLC1A5 (Homo sapiens) 6480464 bisphenol A affects the expression of SLC1A5 mRNA CTD PMID:20170705 and PMID:30903817 Slc1a5 Rat bisphenol A multiple interactions ISO Slc1a5 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of SLC1A5 mRNA CTD PMID:37364641 Slc1a5 Rat bisphenol A decreases expression ISO SLC1A5 (Homo sapiens) 6480464 bisphenol A results in decreased expression of SLC1A5 protein CTD PMID:37567409 Slc1a5 Rat bisphenol A increases expression ISO Slc1a5 (Mus musculus) 6480464 bisphenol A results in increased expression of SLC1A5 mRNA CTD PMID:32156529 and PMID:38701888 Slc1a5 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SLC1A5 mRNA CTD PMID:25181051 more ... Slc1a5 Rat bisphenol A increases expression ISO SLC1A5 (Homo sapiens) 6480464 bisphenol A results in increased expression of SLC1A5 mRNA CTD PMID:19371625 and PMID:29275510 Slc1a5 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SLC1A5 mRNA and bisphenol A results in increased expression of SLC1A5 protein CTD PMID:17010207 and PMID:32145629 Slc1a5 Rat bisphenol AF increases expression ISO SLC1A5 (Homo sapiens) 6480464 bisphenol AF results in increased expression of SLC1A5 protein CTD PMID:34186270 Slc1a5 Rat bisphenol F decreases expression ISO Slc1a5 (Mus musculus) 6480464 bisphenol F results in decreased expression of SLC1A5 mRNA CTD PMID:38685157 Slc1a5 Rat bisphenol F increases expression ISO SLC1A5 (Homo sapiens) 6480464 bisphenol F results in increased expression of SLC1A5 protein CTD PMID:34186270 Slc1a5 Rat Butylbenzyl phthalate multiple interactions ISO Slc1a5 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of SLC1A5 mRNA CTD PMID:37364641 Slc1a5 Rat cadmium atom multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of SLC1A5 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of SLC1A5 protein CTD PMID:38195004 Slc1a5 Rat cadmium atom increases expression ISO Slc1a5 (Mus musculus) 6480464 Cadmium results in increased expression of SLC1A5 protein CTD PMID:39032683 Slc1a5 Rat cadmium atom increases expression ISO SLC1A5 (Homo sapiens) 6480464 Cadmium results in increased expression of SLC1A5 protein CTD PMID:39032683 Slc1a5 Rat cadmium dichloride increases expression ISO SLC1A5 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of SLC1A5 mRNA CTD PMID:25596134 Slc1a5 Rat cadmium dichloride decreases expression ISO SLC1A5 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of SLC1A5 mRNA CTD PMID:38568856 Slc1a5 Rat cadmium dichloride multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of SLC1A5 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of SLC1A5 protein CTD PMID:38195004 Slc1a5 Rat caffeine decreases phosphorylation ISO SLC1A5 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of SLC1A5 protein CTD PMID:35688186 Slc1a5 Rat calcium silicate decreases expression ISO Slc1a5 (Mus musculus) 6480464 calcium silicate results in decreased expression of SLC1A5 mRNA CTD PMID:29279043 Slc1a5 Rat cefaloridine increases expression EXP 6480464 Cephaloridine results in increased expression of SLC1A5 mRNA CTD PMID:18500788 Slc1a5 Rat chloroacetaldehyde affects expression ISO SLC1A5 (Homo sapiens) 6480464 chloroacetaldehyde affects the expression of SLC1A5 mRNA CTD PMID:25596134 Slc1a5 Rat chloropicrin decreases expression ISO SLC1A5 (Homo sapiens) 6480464 chloropicrin results in decreased expression of SLC1A5 mRNA CTD PMID:26352163 Slc1a5 Rat chlorpromazine increases expression EXP 6480464 Chlorpromazine results in increased expression of SLC1A5 mRNA CTD PMID:25596134 Slc1a5 Rat chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of SLC1A5 mRNA CTD PMID:20600679 Slc1a5 Rat chlorpyrifos multiple interactions ISO Slc1a5 (Mus musculus) 6480464 [Chlorpyrifos co-treated with NGF protein] results in increased expression of SLC1A5 mRNA CTD PMID:20600679 Slc1a5 Rat choline multiple interactions ISO Slc1a5 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of SLC1A5 mRNA CTD PMID:20938992 Slc1a5 Rat cidofovir anhydrous increases expression ISO SLC1A5 (Homo sapiens) 6480464 Cidofovir results in increased expression of SLC1A5 mRNA CTD PMID:25596134 Slc1a5 Rat cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of SLC1A5 mRNA CTD PMID:21080177 Slc1a5 Rat cisplatin increases expression ISO SLC1A5 (Homo sapiens) 6480464 Cisplatin results in increased expression of SLC1A5 mRNA CTD PMID:25596134 Slc1a5 Rat cisplatin decreases expression ISO SLC1A5 (Homo sapiens) 6480464 Cisplatin results in decreased expression of SLC1A5 mRNA CTD PMID:24211769 Slc1a5 Rat clodronic acid decreases expression ISO SLC1A5 (Homo sapiens) 6480464 Clodronic Acid results in decreased expression of SLC1A5 mRNA CTD PMID:25596134 Slc1a5 Rat cobalt dichloride decreases expression ISO SLC1A5 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of SLC1A5 mRNA CTD PMID:19320972 Slc1a5 Rat colforsin daropate hydrochloride decreases expression ISO SLC1A5 (Homo sapiens) 6480464 Colforsin results in decreased expression of SLC1A5 mRNA and Colforsin results in decreased expression of SLC1A5 protein CTD PMID:37385477 Slc1a5 Rat colforsin daropate hydrochloride multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 Valproic Acid promotes the reaction [Colforsin results in decreased expression of SLC1A5 protein] CTD PMID:37385477 Slc1a5 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of SLC1A5 mRNA CTD PMID:26033743 Slc1a5 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of SLC1A5 mRNA CTD PMID:26033743 Slc1a5 Rat corosolic acid increases expression ISO SLC1A5 (Homo sapiens) 6480464 corosolic acid results in increased expression of SLC1A5 mRNA CTD PMID:37939859 Slc1a5 Rat coumarin affects phosphorylation ISO SLC1A5 (Homo sapiens) 6480464 coumarin affects the phosphorylation of SLC1A5 protein CTD PMID:35688186 Slc1a5 Rat crocidolite asbestos decreases expression ISO Slc1a5 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of SLC1A5 mRNA CTD PMID:29279043 Slc1a5 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of SLC1A5 mRNA CTD PMID:26577399 Slc1a5 Rat cyclosporin A increases expression ISO SLC1A5 (Homo sapiens) 6480464 Cyclosporine results in increased expression of SLC1A5 mRNA CTD PMID:20106945 more ... Slc1a5 Rat deoxynivalenol decreases expression ISO SLC1A5 (Homo sapiens) 6480464 deoxynivalenol results in decreased expression of SLC1A5 mRNA CTD PMID:31863870 Slc1a5 Rat dexamethasone multiple interactions ISO Slc1a5 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS protein] results in increased expression of SLC1A5 mRNA CTD PMID:24848799 Slc1a5 Rat dextran sulfate multiple interactions ISO Slc1a5 (Mus musculus) 6480464 Erianin inhibits the reaction [Dextran Sulfate results in decreased expression of SLC1A5 protein] CTD PMID:32272095 Slc1a5 Rat dextran sulfate decreases expression ISO Slc1a5 (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of SLC1A5 protein CTD PMID:32272095 Slc1a5 Rat Di-n-octyl phthalate multiple interactions ISO Slc1a5 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of SLC1A5 mRNA CTD PMID:37364641 Slc1a5 Rat diazinon multiple interactions ISO Slc1a5 (Mus musculus) 6480464 [Diazinon co-treated with NGF protein] results in increased expression of SLC1A5 mRNA CTD PMID:20600679 Slc1a5 Rat Dibutyl phosphate affects expression ISO SLC1A5 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of SLC1A5 mRNA CTD PMID:37042841 Slc1a5 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of SLC1A5 mRNA CTD PMID:21266533 Slc1a5 Rat dibutyl phthalate multiple interactions ISO Slc1a5 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of SLC1A5 mRNA CTD PMID:37364641 Slc1a5 Rat dieldrin multiple interactions ISO Slc1a5 (Mus musculus) 6480464 [Dieldrin co-treated with NGF protein] results in increased expression of SLC1A5 mRNA CTD PMID:20600679 Slc1a5 Rat diethyl phthalate multiple interactions ISO Slc1a5 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of SLC1A5 mRNA CTD PMID:37364641 Slc1a5 Rat Diisodecyl phthalate multiple interactions ISO Slc1a5 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of SLC1A5 mRNA CTD PMID:37364641 Slc1a5 Rat diisononyl phthalate multiple interactions ISO Slc1a5 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of SLC1A5 mRNA CTD PMID:37364641 Slc1a5 Rat dioxygen decreases expression ISO SLC1A5 (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of SLC1A5 mRNA CTD PMID:25596134 Slc1a5 Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of SLC1A5 mRNA CTD PMID:33729688 Slc1a5 Rat disodium selenite increases expression ISO SLC1A5 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of SLC1A5 mRNA CTD PMID:24383545 Slc1a5 Rat dithioerythritol multiple interactions EXP 6480464 Dithioerythritol inhibits the reaction [Thiazoles analog results in decreased activity of SLC1A5 protein] CTD PMID:23010140 Slc1a5 Rat doxorubicin decreases expression ISO SLC1A5 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of SLC1A5 mRNA CTD PMID:29803840 Slc1a5 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of SLC1A5 mRNA CTD PMID:29391264 Slc1a5 Rat enniatin multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [beauvericin co-treated with enniatins] results in increased expression of SLC1A5 protein CTD PMID:32407736 Slc1a5 Rat enzyme inhibitor multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of SLC1A5 protein CTD PMID:23301498 Slc1a5 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of SLC1A5 mRNA CTD PMID:20655511 Slc1a5 Rat ethanol increases expression ISO Slc1a5 (Mus musculus) 6480464 Ethanol results in increased expression of SLC1A5 mRNA CTD PMID:19167417 Slc1a5 Rat etoposide decreases expression ISO SLC1A5 (Homo sapiens) 6480464 Etoposide results in decreased expression of SLC1A5 mRNA CTD PMID:24211769 Slc1a5 Rat folic acid multiple interactions ISO Slc1a5 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Slc1a5 Rat folic acid decreases expression ISO Slc1a5 (Mus musculus) 6480464 Folic Acid results in decreased expression of SLC1A5 mRNA CTD PMID:25629700 Slc1a5 Rat formaldehyde increases expression ISO Slc1a5 (Mus musculus) 6480464 Formaldehyde results in increased expression of SLC1A5 mRNA CTD PMID:33259821 Slc1a5 Rat FR900359 affects phosphorylation ISO SLC1A5 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of SLC1A5 protein CTD PMID:37730182 Slc1a5 Rat furfural multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of SLC1A5 protein CTD PMID:38598786 Slc1a5 Rat genistein increases expression EXP 6480464 Genistein results in increased expression of SLC1A5 mRNA CTD PMID:17010207 Slc1a5 Rat genistein increases expression ISO SLC1A5 (Homo sapiens) 6480464 Genistein results in increased expression of SLC1A5 mRNA CTD PMID:19371625 and PMID:23019147 Slc1a5 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of SLC1A5 mRNA CTD PMID:22061828 Slc1a5 Rat hydroxyurea decreases expression ISO SLC1A5 (Homo sapiens) 6480464 Hydroxyurea results in decreased expression of SLC1A5 mRNA CTD PMID:24211769 Slc1a5 Rat ifosfamide increases expression ISO SLC1A5 (Homo sapiens) 6480464 Ifosfamide results in increased expression of SLC1A5 mRNA CTD PMID:25596134 Slc1a5 Rat Indeno[1,2,3-cd]pyrene decreases expression ISO Slc1a5 (Mus musculus) 6480464 indeno(1 more ... CTD PMID:26377693 Slc1a5 Rat ivermectin decreases expression ISO SLC1A5 (Homo sapiens) 6480464 Ivermectin results in decreased expression of SLC1A5 protein CTD PMID:32959892 Slc1a5 Rat L-methionine multiple interactions ISO Slc1a5 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of SLC1A5 mRNA CTD PMID:20938992 Slc1a5 Rat lamivudine multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [Zidovudine co-treated with Lamivudine] results in increased expression of SLC1A5 mRNA CTD PMID:15784690 Slc1a5 Rat lipopolysaccharide increases expression ISO Slc1a5 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of SLC1A5 mRNA CTD PMID:12057914 Slc1a5 Rat lipopolysaccharide multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of SLC1A5 mRNA CTD PMID:35877022 Slc1a5 Rat Lobetyolin decreases expression ISO SLC1A5 (Homo sapiens) 6480464 lobetyolin results in decreased expression of SLC1A5 mRNA and lobetyolin results in decreased expression of SLC1A5 protein CTD PMID:34075790 Slc1a5 Rat Lobetyolin multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 AKT1 protein inhibits the reaction [lobetyolin results in decreased expression of SLC1A5 protein] and benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [lobetyolin results in decreased expression of SLC1A5 protein] CTD PMID:34075790 Slc1a5 Rat maneb multiple interactions ISO Slc1a5 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of SLC1A5 mRNA CTD PMID:36117858 Slc1a5 Rat manganese atom multiple interactions EXP 6480464 Manganese promotes the reaction [PRKCD protein binds to SLC1A5 protein] CTD PMID:21812036 Slc1a5 Rat manganese atom multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SLC1A5 mRNA CTD PMID:39836092 Slc1a5 Rat manganese(0) multiple interactions EXP 6480464 Manganese promotes the reaction [PRKCD protein binds to SLC1A5 protein] CTD PMID:21812036 Slc1a5 Rat manganese(0) multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SLC1A5 mRNA CTD PMID:39836092 Slc1a5 Rat manganese(II) chloride multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SLC1A5 mRNA CTD PMID:39836092 Slc1a5 Rat methylmercury chloride increases expression ISO SLC1A5 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of SLC1A5 mRNA CTD PMID:28001369 Slc1a5 Rat mitomycin C decreases expression ISO SLC1A5 (Homo sapiens) 6480464 Mitomycin results in decreased expression of SLC1A5 mRNA CTD PMID:24211769 Slc1a5 Rat N(4)-hydroxycytidine decreases expression ISO Slc1a5 (Mus musculus) 6480464 N(4)-hydroxycytidine results in decreased expression of SLC1A5 mRNA CTD PMID:37748715 Slc1a5 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [lobetyolin results in decreased expression of SLC1A5 protein] CTD PMID:34075790 Slc1a5 Rat N-methyl-4-phenylpyridinium increases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in increased expression of SLC1A5 mRNA CTD PMID:28801915 Slc1a5 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of SLC1A5 mRNA CTD PMID:20360939 Slc1a5 Rat nickel atom multiple interactions ISO Slc1a5 (Mus musculus) 6480464 [Nickel co-treated with NGF protein] results in increased expression of SLC1A5 mRNA CTD PMID:20600679 Slc1a5 Rat Nonylphenol increases expression EXP 6480464 nonylphenol results in increased expression of SLC1A5 mRNA CTD PMID:17010207 Slc1a5 Rat ochratoxin A decreases expression ISO SLC1A5 (Homo sapiens) 6480464 ochratoxin A results in decreased expression of SLC1A5 mRNA CTD PMID:30559759 Slc1a5 Rat ozone multiple interactions ISO Slc1a5 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of SLC1A5 mRNA CTD PMID:34911549 Slc1a5 Rat paracetamol affects expression ISO Slc1a5 (Mus musculus) 6480464 Acetaminophen affects the expression of SLC1A5 mRNA CTD PMID:17562736 Slc1a5 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of SLC1A5 mRNA CTD PMID:33387578 Slc1a5 Rat paracetamol increases expression ISO SLC1A5 (Homo sapiens) 6480464 Acetaminophen results in increased expression of SLC1A5 mRNA CTD PMID:29067470 Slc1a5 Rat paraquat multiple interactions ISO Slc1a5 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of SLC1A5 mRNA CTD PMID:36117858 Slc1a5 Rat PCB138 multiple interactions ISO Slc1a5 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Slc1a5 Rat pentachlorophenol increases expression ISO Slc1a5 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of SLC1A5 mRNA CTD PMID:23892564 Slc1a5 Rat perfluorohexanesulfonic acid increases splicing ISO Slc1a5 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased splicing of SLC1A5 mRNA CTD PMID:37995155 Slc1a5 Rat perfluorohexanesulfonic acid decreases expression ISO Slc1a5 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of SLC1A5 mRNA CTD PMID:37995155 Slc1a5 Rat perfluorononanoic acid increases expression ISO SLC1A5 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in increased expression of SLC1A5 mRNA CTD PMID:32588087 Slc1a5 Rat perfluorooctane-1-sulfonic acid increases expression ISO SLC1A5 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in increased expression of SLC1A5 mRNA CTD PMID:32588087 and PMID:36864359 Slc1a5 Rat phenethyl caffeate multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of SLC1A5 mRNA CTD PMID:20360939 Slc1a5 Rat phenobarbital multiple interactions ISO Slc1a5 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of SLC1A5 mRNA] CTD PMID:19482888 Slc1a5 Rat phenobarbital increases expression ISO Slc1a5 (Mus musculus) 6480464 Phenobarbital results in increased expression of SLC1A5 mRNA CTD PMID:19482888 Slc1a5 Rat phorbol 13-acetate 12-myristate decreases expression EXP 6480464 Tetradecanoylphorbol Acetate results in decreased expression of SLC1A5 protein CTD PMID:21812036 Slc1a5 Rat resveratrol increases expression ISO SLC1A5 (Homo sapiens) 6480464 resveratrol results in increased expression of SLC1A5 mRNA CTD PMID:19371625 Slc1a5 Rat S-(1,2-dichlorovinyl)-L-cysteine increases expression ISO SLC1A5 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in increased expression of SLC1A5 mRNA CTD PMID:33725128 Slc1a5 Rat SB 431542 multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of SLC1A5 protein CTD PMID:37664457 Slc1a5 Rat serpentine asbestos increases expression ISO SLC1A5 (Homo sapiens) 6480464 Asbestos and Serpentine results in increased expression of SLC1A5 mRNA CTD PMID:29523930 Slc1a5 Rat sodium arsenite increases expression ISO Slc1a5 (Mus musculus) 6480464 sodium arsenite results in increased expression of SLC1A5 mRNA CTD PMID:31170414 Slc1a5 Rat sodium arsenite multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SLC1A5 mRNA more ... CTD PMID:33781819 and PMID:39836092 Slc1a5 Rat sodium arsenite increases expression ISO SLC1A5 (Homo sapiens) 6480464 sodium arsenite results in increased expression of SLC1A5 mRNA and sodium arsenite results in increased expression of SLC1A5 protein CTD PMID:33781819 and PMID:38568856 Slc1a5 Rat sodium chloride multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of SLC1A5 protein more ... CTD PMID:38598786 Slc1a5 Rat sulforaphane increases expression ISO SLC1A5 (Homo sapiens) 6480464 sulforaphane results in increased expression of SLC1A5 mRNA CTD PMID:31838189 Slc1a5 Rat sunitinib increases expression ISO SLC1A5 (Homo sapiens) 6480464 Sunitinib results in increased expression of SLC1A5 mRNA CTD PMID:31533062 Slc1a5 Rat T-2 toxin decreases expression ISO SLC1A5 (Homo sapiens) 6480464 T-2 Toxin results in decreased expression of SLC1A5 mRNA CTD PMID:31863870 Slc1a5 Rat tamoxifen increases expression ISO Slc1a5 (Mus musculus) 6480464 Tamoxifen results in increased expression of SLC1A5 mRNA CTD PMID:25123088 Slc1a5 Rat tetrachloromethane affects expression ISO Slc1a5 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of SLC1A5 mRNA CTD PMID:17484886 Slc1a5 Rat thiazoles decreases activity EXP 6480464 Thiazoles analog results in decreased activity of SLC1A5 protein CTD PMID:23010140 Slc1a5 Rat thiazoles multiple interactions EXP 6480464 Dithioerythritol inhibits the reaction [Thiazoles analog results in decreased activity of SLC1A5 protein] CTD PMID:23010140 Slc1a5 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of SLC1A5 mRNA CTD PMID:23411599 and PMID:34492290 Slc1a5 Rat thiram increases expression ISO SLC1A5 (Homo sapiens) 6480464 Thiram results in increased expression of SLC1A5 mRNA CTD PMID:38568856 Slc1a5 Rat titanium dioxide decreases methylation ISO Slc1a5 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of SLC1A5 gene CTD PMID:35295148 Slc1a5 Rat titanium dioxide decreases expression ISO SLC1A5 (Homo sapiens) 6480464 titanium dioxide results in decreased expression of SLC1A5 protein CTD PMID:30910687 Slc1a5 Rat tolcapone affects binding EXP 6480464 tolcapone binds to SLC1A5 protein CTD PMID:19783845 Slc1a5 Rat tributylstannane increases expression ISO Slc1a5 (Mus musculus) 6480464 tributyltin results in increased expression of SLC1A5 mRNA CTD PMID:24848799 Slc1a5 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of SLC1A5 mRNA CTD PMID:33387578 Slc1a5 Rat Triptolide increases expression ISO Slc1a5 (Mus musculus) 6480464 triptolide results in increased expression of SLC1A5 mRNA CTD PMID:32835833 Slc1a5 Rat trovafloxacin decreases expression ISO Slc1a5 (Mus musculus) 6480464 trovafloxacin results in decreased expression of SLC1A5 mRNA CTD PMID:35537566 Slc1a5 Rat tunicamycin increases expression ISO SLC1A5 (Homo sapiens) 6480464 Tunicamycin results in increased expression of SLC1A5 mRNA CTD PMID:29453283 Slc1a5 Rat valproic acid increases methylation ISO SLC1A5 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of SLC1A5 gene CTD PMID:29154799 Slc1a5 Rat valproic acid multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 Valproic Acid promotes the reaction [Colforsin results in decreased expression of SLC1A5 protein] CTD PMID:37385477 Slc1a5 Rat valproic acid affects expression ISO Slc1a5 (Mus musculus) 6480464 Valproic Acid affects the expression of SLC1A5 mRNA CTD PMID:17963808 Slc1a5 Rat XL147 multiple interactions ISO Slc1a5 (Mus musculus) 6480464 XL147 inhibits the reaction [N-nitroso-tris-chloroethylurea results in increased expression of SLC1A5 mRNA] CTD PMID:29891994 Slc1a5 Rat zearalenone increases expression ISO SLC1A5 (Homo sapiens) 6480464 Zearalenone results in increased expression of SLC1A5 mRNA CTD PMID:19371625 Slc1a5 Rat zearalenone decreases expression EXP 6480464 Zearalenone results in decreased expression of SLC1A5 mRNA and Zearalenone results in decreased expression of SLC1A5 protein CTD PMID:32858132 Slc1a5 Rat zidovudine multiple interactions ISO SLC1A5 (Homo sapiens) 6480464 [Zidovudine co-treated with Lamivudine] results in increased expression of SLC1A5 mRNA CTD PMID:15784690 Slc1a5 Rat zinc dichloride decreases expression ISO SLC1A5 (Homo sapiens) 6480464 zinc chloride results in decreased expression of SLC1A5 mRNA CTD PMID:18947441 Slc1a5 Rat zoledronic acid decreases expression ISO SLC1A5 (Homo sapiens) 6480464 zoledronic acid results in decreased expression of SLC1A5 mRNA CTD PMID:25596134
Imported Annotations - SMPDB
(-)-alpha-phellandrene (ISO) (S)-colchicine (ISO) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-dimethoxyphenol (ISO) 2-bromohexadecanoic acid (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) acetamide (EXP) acrylamide (ISO) adenine (ISO) aflatoxin B1 (EXP,ISO) alpha-phellandrene (ISO) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) atrazine (EXP) Bardoxolone methyl (ISO) beauvericin (ISO) benzo[a]pyrene (ISO) benzoates (ISO) beta-naphthoflavone (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) Butylbenzyl phthalate (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) calcium silicate (ISO) cefaloridine (EXP) chloroacetaldehyde (ISO) chloropicrin (ISO) chlorpromazine (EXP) chlorpyrifos (EXP,ISO) choline (ISO) cidofovir anhydrous (ISO) cisplatin (EXP,ISO) clodronic acid (ISO) cobalt dichloride (ISO) colforsin daropate hydrochloride (ISO) copper atom (EXP) copper(0) (EXP) corosolic acid (ISO) coumarin (ISO) crocidolite asbestos (ISO) Cuprizon (EXP) cyclosporin A (ISO) deoxynivalenol (ISO) dexamethasone (ISO) dextran sulfate (ISO) Di-n-octyl phthalate (ISO) diazinon (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dieldrin (ISO) diethyl phthalate (ISO) Diisodecyl phthalate (ISO) diisononyl phthalate (ISO) dioxygen (EXP,ISO) disodium selenite (ISO) dithioerythritol (EXP) doxorubicin (ISO) endosulfan (EXP) enniatin (ISO) enzyme inhibitor (ISO) ethanol (EXP,ISO) etoposide (ISO) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) furfural (ISO) genistein (EXP,ISO) gentamycin (EXP) hydroxyurea (ISO) ifosfamide (ISO) Indeno[1,2,3-cd]pyrene (ISO) ivermectin (ISO) L-methionine (ISO) lamivudine (ISO) lipopolysaccharide (ISO) Lobetyolin (ISO) maneb (ISO) manganese atom (EXP,ISO) manganese(0) (EXP,ISO) manganese(II) chloride (ISO) methylmercury chloride (ISO) mitomycin C (ISO) N(4)-hydroxycytidine (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-methyl-4-phenylpyridinium (EXP) N-nitrosodiethylamine (EXP) nickel atom (ISO) Nonylphenol (EXP) ochratoxin A (ISO) ozone (ISO) paracetamol (EXP,ISO) paraquat (ISO) PCB138 (ISO) pentachlorophenol (ISO) perfluorohexanesulfonic acid (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) phenethyl caffeate (EXP) phenobarbital (ISO) phorbol 13-acetate 12-myristate (EXP) resveratrol (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) serpentine asbestos (ISO) sodium arsenite (ISO) sodium chloride (ISO) sulforaphane (ISO) sunitinib (ISO) T-2 toxin (ISO) tamoxifen (ISO) tetrachloromethane (ISO) thiazoles (EXP) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) tolcapone (EXP) tributylstannane (ISO) trichloroethene (EXP) Triptolide (ISO) trovafloxacin (ISO) tunicamycin (ISO) valproic acid (ISO) XL147 (ISO) zearalenone (EXP,ISO) zidovudine (ISO) zinc dichloride (ISO) zoledronic acid (ISO)
1.
The astroglial ASCT2 amino acid transporter as a mediator of glutamine efflux.
Broer A, etal., J Neurochem 1999 Nov;73(5):2184-94.
2.
Neutral amino acid transporter ASCT2 displays substrate-induced Na+ exchange and a substrate-gated anion conductance.
Bröer A, etal., Biochem J. 2000 Mar 15;346 Pt 3(Pt 3):705-10.
3.
Tissue-based metabolomics reveals metabolic biomarkers and potential therapeutic targets for esophageal squamous cell carcinoma.
Chen Z, etal., J Pharm Biomed Anal. 2021 Apr 15;197:113937. doi: 10.1016/j.jpba.2021.113937. Epub 2021 Feb 5.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Clinicopathological significance of LAT1 and ASCT2 in patients with surgically resected esophageal squamous cell carcinoma.
Honjo H, etal., J Surg Oncol. 2016 Mar;113(4):381-9. doi: 10.1002/jso.24160. Epub 2016 Mar 3.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Cardiac glutaminolysis: a maladaptive cancer metabolism pathway in the right ventricle in pulmonary hypertension.
Piao L, etal., J Mol Med (Berl). 2013 Oct;91(10):1185-97. doi: 10.1007/s00109-013-1064-7. Epub 2013 Jun 21.
8.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
9.
Identification of a plasma membrane glutamine transporter from the rat hepatoma cell line H4-IIE-C3.
Pollard M, etal., Biochem J 2002 Nov 15;368(Pt 1):371-5.
10.
GOA pipeline
RGD automated data pipeline
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
13.
The l-isomer-selective transport of aspartic acid is mediated by ASCT2 at the blood-brain barrier.
Tetsuka K, etal., J Neurochem. 2003 Nov;87(4):891-901. doi: 10.1046/j.1471-4159.2003.02063.x.
14.
Prognostic significance of amino-acid transporter expression (LAT1, ASCT2, and xCT) in surgically resected tongue cancer.
Toyoda M, etal., Br J Cancer. 2014 May 13;110(10):2506-13. doi: 10.1038/bjc.2014.178. Epub 2014 Apr 24.
15.
Characterization of rapid and high-affinity uptake of L-serine in neurons and astrocytes in primary culture.
Yamamoto T, etal., FEBS Lett. 2003 Jul 31;548(1-3):69-73.
16.
Clinical significance of coexpression of L-type amino acid transporter 1 (LAT1) and ASC amino acid transporter 2 (ASCT2) in lung adenocarcinoma.
Yazawa T, etal., Am J Transl Res. 2015 Jun 15;7(6):1126-39. eCollection 2015.
Slc1a5 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 86,584,949 - 86,599,052 (+) NCBI GRCr8 mRatBN7.2 1 77,456,849 - 77,470,952 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 77,456,694 - 77,470,952 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 82,837,237 - 82,851,346 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 91,401,281 - 91,415,390 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 84,592,328 - 84,606,437 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 78,710,686 - 78,724,789 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 78,710,539 - 78,724,794 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 79,957,648 - 79,971,751 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 77,111,082 - 77,125,166 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 77,189,192 - 77,203,276 (+) NCBI Celera 1 71,941,916 - 71,956,019 (+) NCBI Celera Cytogenetic Map 1 q21 NCBI
SLC1A5 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 46,774,883 - 46,788,594 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 46,774,883 - 46,788,594 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 47,278,140 - 47,291,851 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 51,969,980 - 51,983,653 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 51,969,981 - 51,983,653 NCBI Celera 19 44,082,395 - 44,096,097 (-) NCBI Celera Cytogenetic Map 19 q13.32 NCBI HuRef 19 43,702,915 - 43,716,958 (-) NCBI HuRef CHM1_1 19 47,280,017 - 47,293,715 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 49,600,712 - 49,614,415 (-) NCBI T2T-CHM13v2.0
Slc1a5 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 16,515,259 - 16,532,199 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 16,515,265 - 16,532,199 (+) Ensembl GRCm39 Ensembl GRCm38 7 16,781,334 - 16,798,274 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 16,781,340 - 16,798,274 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 17,366,695 - 17,383,623 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 15,939,929 - 15,956,765 (+) NCBI MGSCv36 mm8 Celera 7 13,979,416 - 13,996,329 (+) NCBI Celera Cytogenetic Map 7 A2 NCBI cM Map 7 9.15 NCBI
Slc1a5 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955574 798,004 - 806,631 (-) NCBI ChiLan1.0 ChiLan1.0
SLC1A5 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 52,922,399 - 52,939,392 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 54,793,572 - 54,807,596 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 43,765,001 - 43,778,981 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 52,294,052 - 52,308,159 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 52,294,655 - 52,307,529 (-) Ensembl panpan1.1 panPan2
SLC1A5 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 109,150,205 - 109,161,375 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 109,150,205 - 109,161,141 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 108,630,028 - 108,640,938 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 109,676,678 - 109,687,827 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 109,676,206 - 109,688,731 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 109,353,817 - 109,364,724 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 108,988,004 - 108,998,931 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 109,856,686 - 109,867,593 (+) NCBI UU_Cfam_GSD_1.0
Slc1a5
SLC1A5 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 52,647,438 - 52,661,459 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 52,647,432 - 52,661,464 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 48,026,660 - 48,032,162 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SLC1A5
Slc1a5
.
Predicted Target Of
Count of predictions: 176 Count of miRNA genes: 71 Interacting mature miRNAs: 82 Transcripts: ENSRNOT00000021455, ENSRNOT00000064332 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331732 Srn4 Serum renin concentration QTL 4 4.467 renin activity (VT:0005581) plasma renin activity level (CMO:0000116) 1 35239598 78430678 Rat 2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1578649 Bmd8 Bone mineral density QTL 8 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 49393172 94393172 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 4889929 Bss87 Bone structure and strength QTL 87 6.7 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 1 53895117 82174945 Rat 1331792 Rf29 Renal function QTL 29 4.589 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 1 35239598 78430678 Rat 2313062 Bmd73 Bone mineral density QTL 73 3.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 11481312 82174945 Rat 8552900 Pigfal1 Plasma insulin-like growth factor 1 level QTL 1 7.4 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1554320 Bmd1 Bone mineral density QTL 1 12.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 509108 86060548 Rat 1354643 Foco2 Food consumption QTL 2 7.17 0.0001 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 1 33449848 78449848 Rat 2302059 Pia36 Pristane induced arthritis QTL 36 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 43333002 88333002 Rat 2313065 Bss67 Bone structure and strength QTL 67 3.1 0.0001 tibia area (VT:1000281) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 2313069 Bss68 Bone structure and strength QTL 68 2.9 0.0001 tibia size trait (VT:0100001) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 2313075 Bss66 Bone structure and strength QTL 66 3.4 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 11481312 82174945 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 631512 Scl6 Serum cholesterol level QTL 6 9.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 72197680 90508767 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 2313077 Bss69 Bone structure and strength QTL 69 3.5 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 11481312 82174945 Rat 1331778 Rf28 Renal function QTL 28 4.66 urine potassium amount (VT:0010539) urine potassium excretion rate (CMO:0000761) 1 45803140 78430678 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 1331785 Rf27 Renal function QTL 27 4.643 urine sodium amount (VT:0006274) urine sodium level (CMO:0000129) 1 28879780 78430678 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 1300172 Bp172 Blood pressure QTL 172 3.56 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 32737273 90665040 Rat 4889962 Bss94 Bone structure and strength QTL 94 3.8 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 1 49361465 82174945 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 6903308 Scl36 Serum cholesterol QTL 36 2 0.0125 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 53863041 90532583 Rat 2313092 Bmd72 Bone mineral density QTL 72 2.5 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 11481312 82174945 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 2313097 Bss70 Bone structure and strength QTL 70 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 9589820 Insglur3 Insulin/glucose ratio QTL 3 10.75 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 1 34836858 79836858 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 1354599 Bw29 Body weight QTL 29 3.46 0.001 body mass (VT:0001259) body weight (CMO:0000012) 1 33449848 78449848 Rat 4889919 Bss86 Bone structure and strength QTL 86 4.1 tibia area (VT:1000281) tibia midshaft total cross-sectional area (CMO:0001715) 1 53895117 82174945 Rat 8552948 Pigfal11 Plasma insulin-like growth factor 1 level QTL 11 4.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat
D1Wox77
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 77,470,700 - 77,470,898 (+) MAPPER mRatBN7.2 Rnor_6.0 1 78,724,538 - 78,724,735 NCBI Rnor6.0 Rnor_5.0 1 79,971,500 - 79,971,697 UniSTS Rnor5.0 RGSC_v3.4 1 77,124,915 - 77,125,112 UniSTS RGSC3.4 Celera 1 71,955,768 - 71,955,965 UniSTS Cytogenetic Map 1 q21 UniSTS
AU048745
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 5 q32 UniSTS Cytogenetic Map 13 q24 UniSTS Cytogenetic Map 6 q32 UniSTS Cytogenetic Map 17 p12 UniSTS Cytogenetic Map 16 p14 UniSTS Cytogenetic Map 13 q26 UniSTS Cytogenetic Map 10 q22 UniSTS Cytogenetic Map 7 q11 UniSTS Cytogenetic Map 8 q24 UniSTS Cytogenetic Map 5 q21 UniSTS Cytogenetic Map 4 q24 UniSTS Cytogenetic Map 2 q11 UniSTS Cytogenetic Map 1 q54 UniSTS Cytogenetic Map 1 q36 UniSTS Cytogenetic Map 18 p11 UniSTS Cytogenetic Map 13 q13 UniSTS Cytogenetic Map 10 q24 UniSTS Cytogenetic Map 8 q31 UniSTS Cytogenetic Map 3 q21 UniSTS Cytogenetic Map 13 p13 UniSTS Cytogenetic Map 1 q21 UniSTS Cytogenetic Map 11 q23 UniSTS Cytogenetic Map 10 q31 UniSTS Cytogenetic Map 16 q12.2 UniSTS Cytogenetic Map 3 q24 UniSTS Cytogenetic Map 5 q36 UniSTS Cytogenetic Map 3 p13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000021455 ⟹ ENSRNOP00000021455
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 77,456,694 - 77,470,952 (+) Ensembl Rnor_6.0 Ensembl 1 78,710,539 - 78,724,794 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000064332 ⟹ ENSRNOP00000060053
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 77,456,694 - 77,470,952 (+) Ensembl Rnor_6.0 Ensembl 1 78,711,077 - 78,724,259 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000111666 ⟹ ENSRNOP00000084829
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 77,456,694 - 77,470,952 (+) Ensembl
RefSeq Acc Id:
NM_175758 ⟹ NP_786934
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 86,584,949 - 86,599,052 (+) NCBI mRatBN7.2 1 77,456,849 - 77,470,952 (+) NCBI Rnor_6.0 1 78,710,686 - 78,724,789 (+) NCBI Rnor_5.0 1 79,957,648 - 79,971,751 (+) NCBI RGSC_v3.4 1 77,111,082 - 77,125,166 (+) RGD Celera 1 71,941,916 - 71,956,019 (+) RGD
Sequence:
CAAGAATCCGAGTCAGGCAGCCTAGACCTGGGATCACGGATCTTGGGTTCCCGGAGCCAGACATCCCGGATCTACACCACCTGAGCGTCCTTAATCCTTCAGGGAATCAAAGACCGCTACGTCCTGAT
hide sequence
RefSeq Acc Id:
XM_039103908 ⟹ XP_038959836
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 86,586,005 - 86,599,052 (+) NCBI mRatBN7.2 1 77,457,908 - 77,470,938 (+) NCBI
RefSeq Acc Id:
NP_786934 ⟸ NM_175758
- UniProtKB:
D3ZJ25 (UniProtKB/Swiss-Prot), Q9Z1J7 (UniProtKB/TrEMBL), F7F8V1 (UniProtKB/TrEMBL)
- Sequence:
MAVDPPKADPKGVVAVDPTANCGSGLKSREDQGAKAGGCCSSRDQVCRCLRANLLVLLTVAAAVAGVVLGLGVSAAGGAEALGHARFTAFAFPGELLLRLLEMIILPLVVCSLIGGAASLDPSALGRL
hide sequence
Ensembl Acc Id:
ENSRNOP00000021455 ⟸ ENSRNOT00000021455
Ensembl Acc Id:
ENSRNOP00000060053 ⟸ ENSRNOT00000064332
RefSeq Acc Id:
XP_038959836 ⟸ XM_039103908
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSRNOP00000084829 ⟸ ENSRNOT00000111666
RGD ID: 13689738 Promoter ID: EPDNEW_R262 Type: multiple initiation site Name: Slc1a5_1 Description: solute carrier family 1 member 5 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 78,710,534 - 78,710,594 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-25
Slc1a5
solute carrier family 1 member 5
Slc1a5
solute carrier family 1 (neutral amino acid transporter), member 5
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-05-19
Slc1a5
solute carrier family 1 (neutral amino acid transporter), member 5
Slc1a7
solute carrier family 1, member 7
Data merged from RGD:628679
737654 APPROVED
2006-03-30
Slc1a5
solute carrier family 1 (neutral amino acid transporter), member 5
sodium-dependent neutral amino acid transporter ASCT2
Name updated
1299863 APPROVED
2004-09-10
Slc1a5
sodium-dependent neutral amino acid transporter ASCT2
Asct2
Symbol and Name updated
1299863 APPROVED
2003-02-27
Slc1a7
solute carrier family 1, member 7
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
expressed in the hepatoma cell line H4-IIE-C3
628314
gene_function
catalyses Na+-dependent glutamine uptake
628314
gene_homology
loop region between transmembrane helices 3 and 4 shares less than 60% sequence similarity with region from ASCT2 in rat liver
628314
gene_homology
nucleotide sequence is 86.4% identical to the rat ASCT2 gene (GenBank AJ132846)
628314
gene_product
member of the ASCT/B0 family of transporters
628314
gene_protein
551 amino acid protein
628314
