Advanced Search (OLGA)

Gene: Adap2 (ArfGAP with dual PH domains 2) Rattus norvegicus

Analyze

Symbol:

Adap2

Name:

ArfGAP with dual PH domains 2

RGD ID:

708487

Description:

Enables phosphatidylinositol binding activity and phosphatidylinositol-3,4-bisphosphate binding activity. Predicted to be involved in heart development. Located in mitochondrial envelope. Orthologous to human ADAP2 (ArfGAP with dual PH domains 2); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

arf-GAP with dual PH domain-containing protein 2; Centa2; centaurin, alpha 2; centaurin-alpha-2; Centaurin-alpha2 protein; cnt-a2; LOC56826

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	65,635,891 - 65,665,019 (+)	NCBI		GRCr8
mRatBN7.2	10	65,138,006 - 65,166,147 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	65,138,020 - 65,165,604 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	69,766,319 - 69,794,270 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	69,271,658 - 69,299,610 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	64,735,665 - 64,763,651 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	67,494,851 - 67,527,582 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	67,494,984 - 67,526,426 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	67,153,666 - 67,166,063 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Rnor_5.0	10	67,176,542 - 67,184,303 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	68,360,450 - 68,390,279 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	68,374,072 - 68,403,895 (+)	NCBI
Celera	10	64,100,093 - 64,126,867 (+)	NCBI		Celera
Cytogenetic Map	10	q25	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

cerebral palsy (ISO)

COVID-19 (ISO)

Developmental Disabilities (ISO)

neurofibromatosis 1 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2-hydroxypropanoic acid (ISO)

3,3',4,4'-tetrachlorobiphenyl (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3-chloropropane-1,2-diol (EXP)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

all-trans-retinoic acid (ISO)

alpha-hexachlorocyclohexane (EXP)

ammonium chloride (EXP)

antirheumatic drug (ISO)

aristolochic acid A (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

choline (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

DDT (EXP)

decabromodiphenyl ether (ISO)

epoxiconazole (ISO)

fenthion (ISO)

flavonoids (EXP)

flutamide (EXP)

folic acid (ISO)

furan (EXP)

hydroquinone (ISO)

ketamine (EXP)

L-methionine (ISO)

methidathion (ISO)

N(4)-hydroxycytidine (ISO)

nefazodone (EXP)

nickel atom (ISO)

nitrofen (EXP)

oxaliplatin (EXP)

ozone (ISO)

paraquat (EXP)

pentanal (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

progesterone (ISO)

propanal (ISO)

propiconazole (ISO)

rac-lactic acid (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium dichromate (ISO)

sodium dodecyl sulfate (ISO)

Soman (EXP)

taurine (ISO)

testosterone (EXP)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

trovafloxacin (EXP,ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

heart development (IBA,ISO,ISS)

Cellular Component

cytoplasm (IBA,ISO,ISS)

intracellular membrane-bounded organelle (IBA)

mitochondrial envelope (IDA)

plasma membrane (IBA,ISO,ISS)

Molecular Function

1-phosphatidylinositol binding (IDA)

GTPase activator activity (IBA,IEA)

inositol 1,3,4,5 tetrakisphosphate binding (ISO,ISS)

phosphatidylinositol bisphosphate binding (IEA)

phosphatidylinositol-3,4,5-trisphosphate binding (IBA,IDA,ISO)

phosphatidylinositol-3,4-bisphosphate binding (IDA)

phosphatidylinositol-4,5-bisphosphate binding (IDA)

protein binding (ISO)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Identification of centaurin-alpha2: a phosphatidylinositide-binding protein present in fat, heart and skeletal muscle.	Whitley P, etal., Eur J Cell Biol 2002 Apr;81(4):222-30.

Additional References at PubMed

PMID:14690521	PMID:16138909

Genomics

Comparative Map Data

Adap2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	65,635,891 - 65,665,019 (+)	NCBI		GRCr8
mRatBN7.2	10	65,138,006 - 65,166,147 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	65,138,020 - 65,165,604 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	69,766,319 - 69,794,270 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	69,271,658 - 69,299,610 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	64,735,665 - 64,763,651 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	67,494,851 - 67,527,582 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	67,494,984 - 67,526,426 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	67,153,666 - 67,166,063 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Rnor_5.0	10	67,176,542 - 67,184,303 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	68,360,450 - 68,390,279 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	68,374,072 - 68,403,895 (+)	NCBI
Celera	10	64,100,093 - 64,126,867 (+)	NCBI		Celera
Cytogenetic Map	10	q25	NCBI

ADAP2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	30,921,945 - 30,959,322 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	30,906,344 - 30,959,945 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	29,248,963 - 29,286,340 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	26,272,880 - 26,310,337 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	26,273,058 - 26,310,335	NCBI
Celera	17	26,169,680 - 26,207,134 (+)	NCBI		Celera
Cytogenetic Map	17	q11.2	NCBI
HuRef	17	25,459,432 - 25,496,890 (+)	NCBI		HuRef
CHM1_1	17	29,311,315 - 29,348,777 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	31,867,653 - 31,905,026 (+)	NCBI		T2T-CHM13v2.0

Adap2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	80,044,869 - 80,071,449 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	80,044,931 - 80,069,784 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	80,154,044 - 80,178,827 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	80,154,105 - 80,178,958 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	79,967,664 - 79,992,329 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	79,970,357 - 79,995,022 (+)	NCBI		MGSCv36	mm8
Celera	11	89,790,391 - 89,815,051 (+)	NCBI		Celera
Cytogenetic Map	11	B5	NCBI
cM Map	11	47.56	NCBI

Adap2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955481	7,068,219 - 7,094,184 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955481	7,068,217 - 7,094,946 (+)	NCBI	ChiLan1.0	ChiLan1.0

ADAP2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	33,557,948 - 33,603,469 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	35,438,995 - 35,480,168 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	25,881,050 - 25,920,260 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	25,371,444 - 25,408,751 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	25,371,444 - 25,408,751 (-)	Ensembl	panpan1.1		panPan2

ADAP2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	40,801,120 - 40,845,248 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	40,819,425 - 40,845,517 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	39,960,027 - 40,003,994 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	41,617,915 - 41,661,889 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	41,634,877 - 41,661,931 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	40,403,473 - 40,447,443 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	40,697,716 - 40,742,096 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	40,772,613 - 40,816,629 (-)	NCBI		UU_Cfam_GSD_1.0

Adap2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	39,889,450 - 39,912,939 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936538	2,765,596 - 2,790,055 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936538	2,767,489 - 2,790,080 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ADAP2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	42,817,669 - 42,849,922 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	42,817,683 - 42,864,594 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	44,622,709 - 44,663,307 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ADAP2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	25,623,548 - 25,658,891 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	25,623,786 - 25,657,029 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666075	4,400,916 - 4,438,777 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Adap2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624875	174,180 - 203,594 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624875	174,272 - 203,501 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	195
Count of miRNA genes:	142
Interacting mature miRNAs:	152
Transcripts:	ENSRNOT00000056273
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	51071897	96071897	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31796281	76796281	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	27023535	98502431	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	27443787	72443787	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	35509383	91417879	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63719161	107713808	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	56868440	76129113	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	27443787	72443787	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42546145	107713808	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	58073360	103073360	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	54296336	99451733	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41831278	86831278	Rat
1579919	Bp281	Blood pressure QTL 281		0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50464802	95464802	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	64939013	107713808	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44939359	89939359	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45529164	96099749	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	54296227	107713808	Rat
10450493	Bp382	Blood pressure QTL 382		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50860288	95860288	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28950353	73950353	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	27443787	72443787	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14991535	86964295	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62556066	107556066	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42823274	87823274	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62556066	107556066	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44939359	89939359	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	27443787	72443787	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42823274	87823274	Rat
2306970	Anxrr22	Anxiety related response QTL 22	5.95		fear/anxiety-related behavior trait (VT:1000241)	number of periods of voluntary immobility (CMO:0001045)	10	61843496	98710773	Rat
2306787	Ean3	Experimental allergic neuritis QTL 3	3.1		nervous system integrity trait (VT:0010566)	body weight loss (CMO:0001399)	10	54296227	67476781	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22931373	91127454	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6660923	73950353	Rat
2306792	Ean4	Experimental allergic neuritis QTL 4	4		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	49495492	94495492	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	52269185	107713808	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15533012	73695498	Rat
634329	Pia15	Pristane induced arthritis QTL 15	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	24662123	73695339	Rat
2298481	Eau9	Experimental allergic uveoretinitis QTL 9		0.0169	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	64139597	83061459	Rat
2298480	Eau7	Experimental allergic uveoretinitis QTL 7		0.0049	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	35509383	80509383	Rat
1358915	Stresp7	Stress response QTL 7	3.52		blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	65307813	107713808	Rat
70363	Bp71	Blood pressure QTL 71		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	61843496	106843496	Rat
61402	Niddm3	Non-insulin dependent diabetes mellitus QTL 3	4.58		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	61843633	83061236	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29800910	91417879	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	27587226	96099902	Rat
2289985	Bp305	Blood pressure QTL 305			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	29076978	74076978	Rat
1354608	Cm33	Cardiac mass QTL 33	2.8		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	10	55307972	93608131	Rat
1558643	Cm44	Cardiac mass QTL 44	4.8	0.0000368	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	61843496	100198886	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	43608793	88608793	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	27443787	72443787	Rat
1331839	Eae18b	Experimental allergic encephalomyelitis QTL 18b	5.8	0.03	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	10	61746532	68282731	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40535708	107713808	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
7207811	Bmd90	Bone mineral density QTL 90	5.2		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	10	49943710	94943710	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31129113	76129113	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44939359	89939359	Rat
631526	Bp76	Blood pressure QTL 76		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	61843633	67241334	Rat
6893336	Cm75	Cardiac mass QTL 75	0.1	0.87	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	61843496	100198886	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47869129	92869129	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6864618	96620484	Rat
12880050	Am10	Aortic mass QTL 10		0.016	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	39503487	84503487	Rat
2292436	Bp310	Blood pressure QTL 310			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50604677	95604677	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	35509383	88177745	Rat
634354	Rends3	Renal damage susceptibility QTL 3		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	10	61997479	106997479	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	27023535	99451848	Rat

Markers in Region

D10Got406

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	65,139,038 - 65,139,251 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	67,495,867 - 67,496,079	NCBI	Rnor6.0
Rnor_5.0	10	67,154,600 - 67,154,812	UniSTS	Rnor5.0
RGSC_v3.4	10	68,361,384 - 68,361,596	UniSTS	RGSC3.4
Celera	10	64,101,027 - 64,101,239	UniSTS
Cytogenetic Map	10	q26	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_020101	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017597484	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086713	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269737	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269738	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269739	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AJ238993	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225344	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000056273 ⟹ ENSRNOP00000053112

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	65,138,020 - 65,165,604 (+)	Ensembl
Rnor_6.0 Ensembl	10	67,494,984 - 67,526,426 (+)	Ensembl

RefSeq Acc Id:

NM_020101 ⟹ NP_064486

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	65,635,990 - 65,663,493 (+)	NCBI
mRatBN7.2	10	65,138,105 - 65,165,611 (+)	NCBI
Rnor_6.0	10	67,494,933 - 67,527,041 (+)	NCBI
Rnor_5.0	10	67,153,666 - 67,166,063 (+)	NCBI
Rnor_5.0	10	67,176,542 - 67,184,303 (+)	NCBI
RGSC_v3.4	10	68,360,450 - 68,390,279 (+)	RGD
Celera	10	64,100,093 - 64,126,867 (+)	RGD

Sequence:

show sequence

CGGAACCACAGAGTTGGCGGGGTTGAGCCCCGCTGAGACCTCTGGGCCGGCCATGGGCGACCGT
GAACGCAACAAGAAGCGGTTGCTGGAGCTGCTGCAGGCTGCGGGCACTGGCAACGGGCACTGCG
CCGACTGCGGGGCAGCGGATCCTGATTGGGCCTCTTACAAGCTGGGGGTTTTCATCTGTCTCCA
CTGCTCTGGCGTCCATCGCAACTTCCCAGACATCAGCAAAGTTAAATCCGTGAGACTGGACTTC
TGGGACGACAGTATGGTGGAGTTCATGACTCACAATGGGAACCTCAGTGTGAAAGCCAAGTTTG
AAGCTAGAGTCCCAACTTTCTACTACGTCCCTCAGGCCAGCGACTGCCTGGTCTTAAAGGAACA
ATGGATTCGAGCTAAGTATGAAAGGCAGGAGTTTATGGCTGAGAAAGCTGTCTCGCCCCCAGGT
GATCGAGAAGGCTTCCTGTGGAAGCGAGGAAGGGACAACTCCCAGTTCCTGAGGAGAAGGTTTG
TCCTTCTGTCAAGGGAAGGCCTGCTGAAGTACTACACCAAGGAAGAGGGTAAAACCCCAAAGGC
TATCATCAACATCAAGGACTTAAATGCCACCTTCCAGACAGAGAAGATTGGACATCCCCACGGG
CTGCAGATTACCTACAGGAAGGAGGGCCAAACCAGAAATCTGTTTGTATATCATGACAGTGGAA
AGGAGATAGTGGATTGGTTCAATGCTCTCCGTGCAGCCCGCCTGCAATACCTAAAATTGGCCTT
TCCTGATCTCCCAGAGTCTGAGCTCGTGCCTCTCATCACCAGGAACTACCTCAAACAAGGCTTC
ATGGAGAAGACTGGTCCAAAGCATAGAGAACCCTTCAAGAAAAGGTGGTTTGCCTTGGATCCTC
AGGAGCGGAGGCTGCTGTATTATAAGAACCCCCTGGACGCTTTTGAGCAGGGCCAGGTTTTTCT
GGGAAGCAATGAGCAGGGATATGAAGTATGGGAAGGCCTGCCCCAGGGCATCCGAGGGAACCGC
TGGAAGGTCGGACTCACGGTCATCACTCCGGAGCGGAAATTCGTCTTCACCTGCCCCACGGAAA
AGGAGCAGCGGGAATGGCTGGAGAGTCTGCGGGGTGTCCTGTCCAGTCCCTTGTCGCCCCTCCA
CCTCCTCACCACATCAGCAAAGAGTGGCTGAGGCCTGAGGTGACCCATCTCGGAGGATCTGGCT
GGCCACTGAGCACCTGAAGTCCTGGAGAAGTGTTCACCTCAGCCCTGGTTGTCCAGAAGGAAGT
CCTGAGGCCAGCAGCTGCCCTTGCCTGTGAACTCTGTGAAGGTGAGGTTTATCCTACGACTCCC
TGGGCTCCTTCCAGAACATTTCCCAGTCTTGAGGAGTTGGGACCGAGAAGAATTCAGCTCTCCA
AGCTTAGATGTCCTCATAACTGCACCGAAAGTCAGCCATGGTGATGCGTGCAAGTTGAGAGGCA
GGAATGCCATGAGCCCAGTGCCAACGTGAACCACCCAAGGAGTTCAAGTCTAGCCTGAATTGCA
TAGCAAGACCTTGTCTCAAACAACAACCAAACAAACAAACAAACAAAAACAAAACAGAAAAAAC
AGCAGTCAGGAGGCAGAGACTGACGGATCCAAGACAGTCACAGCCAAGGCTGGTTACACTGAAA
AACACTGTCTAGAAAAACTAAGAACAAAAAACAGAAACAAAAGCAAGTAAGCAGGGTTGGGGAT
TTAGCTCAGTGGTAGAGCGCTTGCCTAGCAACCGCAAGGCCCTGGGTTCAGTCCCCAGCTCCGA
AAAAAA

hide sequence

RefSeq Acc Id:

XM_039086713 ⟹ XP_038942641

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	65,635,892 - 65,665,019 (+)	NCBI
mRatBN7.2	10	65,138,006 - 65,166,147 (+)	NCBI

RefSeq Acc Id:

XM_063269737 ⟹ XP_063125807

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	65,635,891 - 65,665,019 (+)	NCBI

RefSeq Acc Id:

XM_063269738 ⟹ XP_063125808

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	65,635,894 - 65,665,019 (+)	NCBI

RefSeq Acc Id:

XM_063269739 ⟹ XP_063125809

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	65,636,852 - 65,665,019 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_064486	(Get FASTA)	NCBI Sequence Viewer
	XP_038942641	(Get FASTA)	NCBI Sequence Viewer
	XP_063125807	(Get FASTA)	NCBI Sequence Viewer
	XP_063125808	(Get FASTA)	NCBI Sequence Viewer
	XP_063125809	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAB88403	(Get FASTA)	NCBI Sequence Viewer
	EDM05410	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000053112.5
GenBank Protein	Q9JK15	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_064486 ⟸ NM_020101

- UniProtKB:

Q9JK15 (UniProtKB/Swiss-Prot), A6HHA5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGDRERNKKRLLELLQAAGTGNGHCADCGAADPDWASYKLGVFICLHCSGVHRNFPDISKVKSV
RLDFWDDSMVEFMTHNGNLSVKAKFEARVPTFYYVPQASDCLVLKEQWIRAKYERQEFMAEKAV
SPPGDREGFLWKRGRDNSQFLRRRFVLLSREGLLKYYTKEEGKTPKAIINIKDLNATFQTEKIG
HPHGLQITYRKEGQTRNLFVYHDSGKEIVDWFNALRAARLQYLKLAFPDLPESELVPLITRNYL
KQGFMEKTGPKHREPFKKRWFALDPQERRLLYYKNPLDAFEQGQVFLGSNEQGYEVWEGLPQGI
RGNRWKVGLTVITPERKFVFTCPTEKEQREWLESLRGVLSSPLSPLHLLTTSAKSG

hide sequence

Ensembl Acc Id:

ENSRNOP00000053112 ⟸ ENSRNOT00000056273

RefSeq Acc Id:	XP_038942641 ⟸ XM_039086713
- Peptide Label:	isoform X2
- UniProtKB:	D3ZQG5 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063125807 ⟸ XM_063269737
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063125808 ⟸ XM_063269738
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063125809 ⟸ XM_063269739
- Peptide Label:	isoform X4

Protein Domains

Arf-GAP PH

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9JK15-F1-model_v2	AlphaFold	Q9JK15	1-376	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697498

Promoter ID:

EPDNEW_R8023

Type:

multiple initiation site

Name:

Adap2_1

Description:

ArfGAP with dual PH domains 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	67,494,886 - 67,494,946	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:708487	AgrOrtholog
BioCyc Gene	G2FUF-23981	BioCyc
Ensembl Genes	ENSRNOG00000037148	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000056273.5	UniProtKB/TrEMBL
Gene3D-CATH	1.10.220.150	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	2.30.29.30	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Arf-GAP_dual-PH_domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ARFGAP/RecO	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ArfGAP_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ArfGAP_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PH-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PH1_ADAP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PH2_ADAP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PH_domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:56826	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	56826	ENTREZGENE
PANTHER	ARF-GAP WITH DUAL PH DOMAIN-CONTAINING PROTEIN 1-LIKE PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ARF-GAP WITH DUAL PH DOMAIN-CONTAINING PROTEIN 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	ArfGap	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PF00169	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Adap2	PhenoGen
PRINTS	REVINTRACTNG	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	ARFGAP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PH_DOMAIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000037148	RatGTEx
SMART	ArfGap	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SM00233	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	PH domain-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF57863	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6HHA5	ENTREZGENE, UniProtKB/TrEMBL
	ADAP2_RAT	UniProtKB/Swiss-Prot
	D3ZQG5	ENTREZGENE, UniProtKB/TrEMBL
	Q9JK15	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-10-15	Adap2	ArfGAP with dual PH domains 2	Centa2	centaurin, alpha 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Centa2	centaurin, alpha 2		Centaurin-alpha2 protein	Name updated	1299863	APPROVED
2004-09-10	Centa2	Centaurin-alpha2 protein	LOC56826		Symbol and Name updated	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar