Symbol:
Trim3
Name:
tripartite motif-containing 3
RGD ID:
70074
Description:
Predicted to enable identical protein binding activity and ubiquitin protein ligase activity. Involved in regulation protein catabolic process at postsynapse. Is active in glutamatergic synapse and postsynapse. Orthologous to human TRIM3 (tripartite motif containing 3); INTERACTS WITH ammonium chloride; bisphenol A; cocaine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Berp; brain-expressed RING finger protein; ring finger protein 22; Rnf22; tripartite motif protein 3; tripartite motif-containing protein 3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 169,362,751 - 169,385,430 (-) NCBI GRCr8 mRatBN7.2 1 159,950,921 - 159,973,600 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 159,944,908 - 159,973,600 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 167,973,469 - 167,996,177 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 175,159,470 - 175,182,183 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 168,061,185 - 168,083,921 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 170,441,662 - 170,464,341 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 170,441,639 - 170,464,341 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 177,447,514 - 177,470,193 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 163,337,614 - 163,362,846 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 163,433,089 - 163,458,323 (-) NCBI Celera 1 157,883,619 - 157,906,308 (-) NCBI Celera Cytogenetic Map 1 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Trim3 Rat 1,2-dimethylhydrazine affects expression ISO Trim3 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of TRIM3 mRNA CTD PMID:22206623 Trim3 Rat 1,2-dimethylhydrazine multiple interactions ISO Trim3 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TRIM3 mRNA CTD PMID:22206623 Trim3 Rat 17beta-estradiol affects expression ISO TRIM3 (Homo sapiens) 6480464 Estradiol affects the expression of TRIM3 mRNA CTD PMID:22574217 Trim3 Rat 17beta-estradiol decreases expression ISO Trim3 (Mus musculus) 6480464 Estradiol results in decreased expression of TRIM3 mRNA CTD PMID:19484750 Trim3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Trim3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TRIM3 mRNA CTD PMID:21570461 Trim3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO TRIM3 (Homo sapiens) 6480464 [Tetrachlorodibenzodioxin co-treated with 2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide] results in decreased expression of TRIM3 mRNA CTD PMID:29704546 Trim3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Trim3 (Mus musculus) 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in decreased expression of TRIM3 mRNA CTD PMID:25975270 Trim3 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Trim3 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of TRIM3 mRNA CTD PMID:20188158 Trim3 Rat actinomycin D multiple interactions ISO TRIM3 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of TRIM3 mRNA and [Dactinomycin co-treated with nutlin 3] results in increased secretion of TRIM3 protein CTD PMID:38460933 Trim3 Rat actinomycin D increases expression ISO TRIM3 (Homo sapiens) 6480464 Dactinomycin results in increased expression of TRIM3 mRNA CTD PMID:38460933 Trim3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of TRIM3 mRNA CTD PMID:16483693 Trim3 Rat aristolochic acid A increases expression ISO TRIM3 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of TRIM3 mRNA CTD PMID:33212167 Trim3 Rat atrazine increases expression ISO TRIM3 (Homo sapiens) 6480464 Atrazine results in increased expression of TRIM3 mRNA CTD PMID:22378314 Trim3 Rat benzo[a]pyrene increases expression ISO Trim3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of TRIM3 mRNA CTD PMID:22228805 Trim3 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of TRIM3 mRNA CTD PMID:25181051 Trim3 Rat camptothecin increases expression ISO TRIM3 (Homo sapiens) 6480464 Camptothecin results in increased expression of TRIM3 mRNA CTD PMID:38460933 Trim3 Rat carbon nanotube increases expression ISO Trim3 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of TRIM3 mRNA CTD PMID:25554681 and PMID:25620056 Trim3 Rat CGP 52608 multiple interactions ISO TRIM3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to TRIM3 gene] CTD PMID:28238834 Trim3 Rat chlorpyrifos decreases expression ISO Trim3 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of TRIM3 mRNA CTD PMID:32715474 Trim3 Rat chlorpyrifos increases expression ISO Trim3 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of TRIM3 mRNA CTD PMID:37019170 Trim3 Rat cisplatin multiple interactions ISO TRIM3 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of TRIM3 mRNA CTD PMID:27392435 Trim3 Rat cisplatin increases expression ISO TRIM3 (Homo sapiens) 6480464 Cisplatin results in increased expression of TRIM3 mRNA CTD PMID:27392435 Trim3 Rat clofibrate decreases expression ISO Trim3 (Mus musculus) 6480464 Clofibrate results in decreased expression of TRIM3 mRNA CTD PMID:17585979 Trim3 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of TRIM3 mRNA CTD PMID:20187946 Trim3 Rat diazinon increases methylation ISO TRIM3 (Homo sapiens) 6480464 Diazinon results in increased methylation of TRIM3 gene CTD PMID:22964155 Trim3 Rat Dibutyl phosphate affects expression ISO TRIM3 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of TRIM3 mRNA CTD PMID:37042841 Trim3 Rat ethanol affects expression ISO Trim3 (Mus musculus) 6480464 Ethanol affects the expression of TRIM3 mRNA CTD PMID:30319688 Trim3 Rat ethanol affects splicing ISO Trim3 (Mus musculus) 6480464 Ethanol affects the splicing of TRIM3 mRNA CTD PMID:30319688 Trim3 Rat folic acid multiple interactions ISO Trim3 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TRIM3 mRNA CTD PMID:22206623 Trim3 Rat FR900359 increases phosphorylation ISO TRIM3 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of TRIM3 protein CTD PMID:37730182 Trim3 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of TRIM3 mRNA CTD PMID:33387578 Trim3 Rat hydrogen peroxide decreases expression ISO TRIM3 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of TRIM3 mRNA CTD PMID:18951874 Trim3 Rat ivermectin decreases expression ISO TRIM3 (Homo sapiens) 6480464 Ivermectin results in decreased expression of TRIM3 protein CTD PMID:32959892 Trim3 Rat leflunomide decreases expression ISO TRIM3 (Homo sapiens) 6480464 leflunomide results in decreased expression of TRIM3 mRNA CTD PMID:28988120 Trim3 Rat Nutlin-3 multiple interactions ISO TRIM3 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of TRIM3 mRNA and [Dactinomycin co-treated with nutlin 3] results in increased secretion of TRIM3 protein CTD PMID:38460933 Trim3 Rat pentanal decreases expression ISO TRIM3 (Homo sapiens) 6480464 pentanal results in decreased expression of TRIM3 mRNA CTD PMID:26079696 Trim3 Rat sodium arsenite decreases expression ISO TRIM3 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of TRIM3 protein CTD PMID:30528433 Trim3 Rat sunitinib decreases expression ISO TRIM3 (Homo sapiens) 6480464 Sunitinib results in decreased expression of TRIM3 mRNA CTD PMID:31533062 Trim3 Rat thiabendazole increases expression EXP 6480464 Thiabendazole results in increased expression of TRIM3 mRNA CTD PMID:18539377 Trim3 Rat titanium dioxide decreases methylation ISO Trim3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of TRIM3 gene CTD PMID:35295148 Trim3 Rat urethane increases expression ISO TRIM3 (Homo sapiens) 6480464 Urethane results in increased expression of TRIM3 mRNA CTD PMID:28818685
1.
Cloning and characterization of a novel RING finger protein that interacts with class V myosins.
El-Husseini AE and Vincent SR, J Biol Chem 1999 Jul 9;274(28):19771-7.
2.
BERP, a novel ring finger protein, binds to alpha-actinin-4.
El-Husseini AE, etal., Biochem Biophys Res Commun 2000 Jan 27;267(3):906-11.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Degradation of postsynaptic scaffold GKAP and regulation of dendritic spine morphology by the TRIM3 ubiquitin ligase in rat hippocampal neurons.
Hung AY, etal., PLoS One. 2010 Mar 24;5(3):e9842. doi: 10.1371/journal.pone.0009842.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
GOA pipeline
RGD automated data pipeline
8.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
Trim3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 169,362,751 - 169,385,430 (-) NCBI GRCr8 mRatBN7.2 1 159,950,921 - 159,973,600 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 159,944,908 - 159,973,600 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 167,973,469 - 167,996,177 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 175,159,470 - 175,182,183 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 168,061,185 - 168,083,921 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 170,441,662 - 170,464,341 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 170,441,639 - 170,464,341 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 177,447,514 - 177,470,193 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 163,337,614 - 163,362,846 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 163,433,089 - 163,458,323 (-) NCBI Celera 1 157,883,619 - 157,906,308 (-) NCBI Celera Cytogenetic Map 1 q32 NCBI
TRIM3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 6,448,613 - 6,474,459 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 6,448,613 - 6,474,459 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 6,469,843 - 6,495,689 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 6,426,419 - 6,451,781 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 6,426,419 - 6,451,781 NCBI Celera 11 6,588,902 - 6,614,265 (-) NCBI Celera Cytogenetic Map 11 p15.4 NCBI HuRef 11 6,128,913 - 6,154,761 (-) NCBI HuRef CHM1_1 11 6,468,976 - 6,494,812 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 6,507,075 - 6,532,930 (-) NCBI T2T-CHM13v2.0
Trim3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 105,253,670 - 105,282,805 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 105,253,670 - 105,282,778 (-) Ensembl GRCm39 Ensembl GRCm38 7 105,604,463 - 105,633,574 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 105,604,463 - 105,633,571 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 112,758,984 - 112,782,013 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 105,484,291 - 105,507,320 (-) NCBI MGSCv36 mm8 Celera 7 105,881,750 - 105,896,856 (-) NCBI Celera Cytogenetic Map 7 E3 NCBI cM Map 7 55.91 NCBI
Trim3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955414 22,181,857 - 22,207,244 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955414 22,181,999 - 22,207,244 (-) NCBI ChiLan1.0 ChiLan1.0
TRIM3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 8,885,639 - 8,910,986 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 8,849,520 - 8,874,856 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 6,580,491 - 6,605,854 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 6,263,961 - 6,289,331 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 6,264,376 - 6,281,033 (-) Ensembl panpan1.1 panPan2
TRIM3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 21 29,766,086 - 29,782,573 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 21 29,766,094 - 29,782,538 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 21 29,467,945 - 29,492,844 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 21 30,592,205 - 30,617,117 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 21 30,592,207 - 30,617,114 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 21 29,913,100 - 29,937,976 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 21 30,078,929 - 30,103,828 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 21 30,274,212 - 30,299,108 (-) NCBI UU_Cfam_GSD_1.0
Trim3
TRIM3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 3,272,798 - 3,282,366 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 3,256,915 - 3,281,846 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 3,915,403 - 3,940,027 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TRIM3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 58,353,338 - 58,378,959 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 58,354,117 - 58,379,100 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 156,179,620 - 156,204,596 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Trim3
.
Predicted Target Of
Count of predictions: 83 Count of miRNA genes: 66 Interacting mature miRNAs: 75 Transcripts: ENSRNOT00000024850 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61442 Strs1 Sensitivity to stroke QTL 1 7.4 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 1 121767634 166767634 Rat 1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1598866 Bp287 Blood pressure QTL 287 5.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 1578770 Stresp23 Stress response QTL 23 kidney sympathetic nerve activity (VT:0004050) stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786) 1 123350408 182418476 Rat 70160 Bw18 Body weight QTL 18 5.7 body mass (VT:0001259) body weight (CMO:0000012) 1 144267353 196383668 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 631199 Cm23 Cardiac mass QTL 23 4.6 0.0004 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 115585465 172949803 Rat 1354636 Lmblg1 Limb length QTL 1 6.4 tibia length (VT:0004357) tibia length (CMO:0000450) 1 151162512 201278233 Rat 1598850 Bp297 Blood pressure QTL 297 2.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 1354634 Kidm12 Kidney mass QTL 12 3.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 1 151162512 201278233 Rat 4889428 Stresp24 Stress response QTL 24 0.05 heart pumping trait (VT:2000009) absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162) 1 155866514 200866514 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 61343 Bp28 Blood pressure QTL 28 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 151646613 196646613 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 61348 Bp30 Blood pressure QTL 30 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144017057 197814409 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 2303622 Vencon6 Ventilatory control QTL 6 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 1 154561505 199561505 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 631206 Niddm40 Non-insulin dependent diabetes mellitus QTL 40 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 136745990 163747690 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 9685799 Bp375 Blood pressure QTL 375 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 2293140 Bp313 Blood pressure QTL 313 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121833674 166833674 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 9685802 Bp376 Blood pressure QTL 376 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 126540680 171540680 Rat 1641895 Bp298 Blood pressure QTL 298 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 123350408 182418476 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 634315 Niddm45 Non-insulin dependent diabetes mellitus QTL 45 7.16 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 144267916 172949660 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 61379 Bp44 Blood pressure QTL 44 19.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144267916 174133260 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 2313060 Bss71 Bone structure and strength QTL 71 2.6 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 1 118944747 163944747 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 6893347 Bw98 Body weight QTL 98 0.2 0.53 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 724550 Thym3 Thymus enlargement QTL 3 7.82 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 71118 Thym1 Thymus enlargement QTL 1 10.17 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 631519 Pia11 Pristane induced arthritis QTL 11 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 136830018 181830018 Rat 6893361 Bw104 Body weight QTL 104 0.59 0.27 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 738006 Anxrr14 Anxiety related response QTL 14 4 0.00035 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1558645 Bw55 Body weight QTL 55 3.2 0.004 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 1582204 Livw1 Liver weight QTL 1 3.6 0.0003 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 1 155422851 172949803 Rat 634348 Bp138 Blood pressure QTL 138 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 168883176 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 738028 Anxrr12 Anxiety related response QTL 12 4.9 0.00001 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1354620 Kidm19 Kidney mass QTL 19 4 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 201278233 Rat 8693608 Alc24 Alcohol consumption QTL 24 2.3 0.74 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 150452391 168228760 Rat 1354618 Kidm15 Kidney mass QTL 15 5 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 1 156677124 201278233 Rat 631654 Bp107 Blood pressure QTL 107 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 631544 Bp84 Blood pressure QTL 84 5.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350408 181759564 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 631548 Bp88 Blood pressure QTL 88 5 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 156677124 176484451 Rat 1358189 Cstrr1 Cold stress response QTL 1 0.0001 catecholamine amount (VT:0010543) urine norepinephrine level (CMO:0001629) 1 123350408 182418476 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 1354602 Bw35 Body weight QTL 35 12.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 201278233 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000024850 ⟹ ENSRNOP00000024850
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 159,950,898 - 159,973,600 (-) Ensembl Rnor_6.0 Ensembl 1 170,441,639 - 170,464,341 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000108664 ⟹ ENSRNOP00000087835
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 159,950,898 - 159,973,600 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000114170 ⟹ ENSRNOP00000084221
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 159,944,908 - 159,973,600 (-) Ensembl
RefSeq Acc Id:
NM_031786 ⟹ NP_113974
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 169,362,751 - 169,385,430 (-) NCBI mRatBN7.2 1 159,950,921 - 159,973,600 (-) NCBI Rnor_6.0 1 170,441,662 - 170,464,341 (-) NCBI Rnor_5.0 1 177,447,514 - 177,470,193 (-) NCBI RGSC_v3.4 1 163,337,614 - 163,362,846 (-) RGD Celera 1 157,883,619 - 157,906,308 (-) NCBI
Sequence:
CGCGGCGGCGGCGCCGGCGCGGGGACAGACGGAGGCGCGGGACGTGGGGCGGCGCCGCGGGCAGGGCCGGGCGGACGAGCGCTGGCAGCGGGGGCAGCGCTGCGGGCCGCTCCGAGTGGCTGCAGTCC
hide sequence
RefSeq Acc Id:
XM_039092582 ⟹ XP_038948510
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 169,362,753 - 169,385,424 (-) NCBI mRatBN7.2 1 159,950,923 - 159,973,592 (-) NCBI
RefSeq Acc Id:
XM_039092584 ⟹ XP_038948512
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 169,362,753 - 169,385,424 (-) NCBI mRatBN7.2 1 159,950,923 - 159,973,593 (-) NCBI
RefSeq Acc Id:
XM_039092585 ⟹ XP_038948513
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 169,362,753 - 169,385,411 (-) NCBI mRatBN7.2 1 159,950,923 - 159,973,575 (-) NCBI
RefSeq Acc Id:
XM_039092586 ⟹ XP_038948514
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 169,362,753 - 169,372,063 (-) NCBI mRatBN7.2 1 159,950,923 - 159,973,594 (-) NCBI
RefSeq Acc Id:
XM_063275581 ⟹ XP_063131651
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 169,362,753 - 169,385,411 (-) NCBI
RefSeq Acc Id:
NP_113974 ⟸ NM_031786
- UniProtKB:
O70277 (UniProtKB/Swiss-Prot), A6I7K0 (UniProtKB/TrEMBL), G3V8D6 (UniProtKB/TrEMBL)
- Sequence:
MAKREDSPGPEVQPMDKQFLVCSICLDRYRCPKVLPCLHTFCERCLQNYIPPQSLTLSCPVCRQTSILPEQGVSALQNNFFISSLMEAMQQAPDGAHDPEDPHPLSAVAGRPLSCPNHEGKTMEFYCE
hide sequence
Ensembl Acc Id:
ENSRNOP00000024850 ⟸ ENSRNOT00000024850
RefSeq Acc Id:
XP_038948514 ⟸ XM_039092586
- Peptide Label:
isoform X3
- UniProtKB:
O70277 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038948512 ⟸ XM_039092584
- Peptide Label:
isoform X1
- UniProtKB:
O70277 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038948510 ⟸ XM_039092582
- Peptide Label:
isoform X1
- UniProtKB:
O70277 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038948513 ⟸ XM_039092585
- Peptide Label:
isoform X1
- UniProtKB:
O70277 (UniProtKB/Swiss-Prot)
Ensembl Acc Id:
ENSRNOP00000084221 ⟸ ENSRNOT00000114170
Ensembl Acc Id:
ENSRNOP00000087835 ⟸ ENSRNOT00000108664
RefSeq Acc Id:
XP_063131651 ⟸ XM_063275581
- Peptide Label:
isoform X2
- UniProtKB:
O70277 (UniProtKB/Swiss-Prot), A6I7K0 (UniProtKB/TrEMBL), G3V8D6 (UniProtKB/TrEMBL)
RGD ID: 13690287 Promoter ID: EPDNEW_R812 Type: initiation region Name: Trim3_1 Description: tripartite motif-containing 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 170,464,363 - 170,464,423 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-31
Trim3
tripartite motif-containing 3
Trim3
tripartite motif protein 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Trim3
tripartite motif protein 3
Symbol and Name status set to approved
70586 APPROVED
2002-02-26
Trim3
tripartite motif protein 3
Symbol and Name updated to reflect Human and Mouse nomenclature
70292 APPROVED
Note Type
Note
Reference
gene_domains
contains an N-terminal RING finger, a B-box zinc finger, a coiled-coil (RBCC domain), and a unique C-terminal beta-propeller domain
68906
gene_expression
highly expressed in brain
68906
gene_function
binds to the class V myosin Myr6 (myosin Vb) tail
68906
gene_process
involved in protein dimerization
68906
gene_process
may have a role in myosin V-mediated cargo transport
68906
