Advanced Search (OLGA)

Gene: Ccnh (cyclin H) Rattus norvegicus

Analyze

Symbol:

Ccnh

Name:

cyclin H

RGD ID:

69419

Description:

Predicted to enable cyclin-dependent protein serine/threonine kinase regulator activity and kinase activity. Predicted to contribute to RNA polymerase II general transcription initiation factor activity. Predicted to be involved in several processes, including protein stabilization; regulation of G1/S transition of mitotic cell cycle; and transcription initiation at RNA polymerase II promoter. Predicted to be located in male germ cell nucleus. Predicted to be part of CAK-ERCC2 complex; transcription factor TFIIH core complex; and transcription factor TFIIK complex. Predicted to be active in nucleus. Biomarker of transient cerebral ischemia. Orthologous to human CCNH (cyclin H); PARTICIPATES IN RNA polymerase II transcription initiation pathway; cell cycle pathway, mitotic; nucleotide excision repair pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

cyclin-H

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CCNH (cyclin H)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ccnh (cyclin H)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ccnh (cyclin H)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CCNH (cyclin H)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CCNH (cyclin H)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ccnh (cyclin H)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CCNH (cyclin H)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CCNH (cyclin H)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ccnh (cyclin H)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ccnh (cyclin H)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	DEFB135 (defensin beta 135)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CCNH (cyclin H)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ccnh (cyclin H)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ccnh (cyclin H)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CCL1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CCL1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CycH	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ccnh	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ccnh	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	17,570,449 - 17,591,078 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	17,570,263 - 17,614,860 (+)	Ensembl				GRCr8
mRatBN7.2	2	15,835,064 - 15,855,648 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	15,834,833 - 15,855,819 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	22,936,030 - 22,956,622 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	21,036,283 - 21,056,875 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	15,710,083 - 15,730,675 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	13,593,100 - 13,613,910 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	13,593,100 - 13,613,910 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	13,446,659 - 13,467,469 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	14,179,894 - 14,200,704 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	12,100,804 - 12,121,614 (+)	NCBI		Celera
RGSC_v3.1	2	14,100,262 - 14,121,073 (+)	NCBI
Cytogenetic Map	2	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Animal Mammary Neoplasms (ISO)

basal cell carcinoma (ISO)

Breast Neoplasms (ISO)

Capillary Malformation-Arteriovenous Malformation (ISO)

carcinoma (ISO)

Colonic Neoplasms (ISO)

Esophageal Neoplasms (ISO)

Experimental Mammary Neoplasms (IEP,ISO)

glioblastoma (ISO)

Liver Neoplasms (ISO)

lung non-small cell carcinoma (ISO)

Lymphatic Metastasis (ISO)

Ovarian Neoplasms (ISO)

Prostatic Neoplasms (ISO)

Spinal Cord Injuries (IEP)

Sturge-Weber syndrome (ISO)

transient cerebral ischemia (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

(S)-naringenin (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

4-hydroxyphenyl retinamide (ISO)

4-nitrophenol (ISO)

5-aza-2'-deoxycytidine (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

antimycin A (ISO)

arecoline (ISO)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP)

caffeine (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

clofibric acid (EXP)

cyclosporin A (ISO)

deguelin (ISO)

diarsenic trioxide (ISO)

diazinon (EXP)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

diclofenac (ISO)

dicrotophos (ISO)

dieldrin (EXP)

doxorubicin (ISO)

ethanol (ISO)

FR900359 (ISO)

gentamycin (EXP)

GSK-J4 (ISO)

ivermectin (ISO)

leflunomide (ISO)

levetiracetam (EXP)

mercury dichloride (ISO)

N-methyl-N'-nitro-N-nitrosoguanidine (ISO)

N-nitrosodiethylamine (EXP,ISO)

nickel dichloride (EXP)

paclitaxel (ISO)

paracetamol (EXP)

paraquat (EXP)

PhIP (EXP)

pirinixic acid (ISO)

pyrimidifen (ISO)

rotenone (ISO)

sodium arsenite (ISO)

tebufenpyrad (ISO)

Tributyltin oxide (EXP)

trichostatin A (ISO)

trimellitic anhydride (ISO)

triptonide (ISO)

tungsten (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

DNA-templated transcription (IEA)

protein stabilization (ISO)

regulation of G1/S transition of mitotic cell cycle (ISO)

regulation of transcription by RNA polymerase II (IEA,ISO,ISS)

transcription initiation at RNA polymerase II promoter (IBA,ISO)

Cellular Component

CAK-ERCC2 complex (ISO)

cyclin-dependent protein kinase holoenzyme complex (ISO)

nucleoplasm (ISO)

nucleus (IBA,IEA,ISO)

transcription factor TFIIH core complex (ISO)

transcription factor TFIIH holo complex (ISO,ISS)

transcription factor TFIIK complex (IBA,IEA,ISO)

Molecular Function

cyclin-dependent protein serine/threonine kinase regulator activity (IBA,IEA)

kinase activity (ISO)

protein binding (ISO)

RNA polymerase II general transcription initiation factor activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

cell cycle pathway, mitotic (IEA)

nucleotide excision repair pathway (IEA)

RNA polymerase II transcription initiation pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	A history of TFIIH: two decades of molecular biology on a pivotal transcription/repair factor.	Egly JM and Coin F, DNA Repair (Amst). 2011 Jul 15;10(7):714-21. doi: 10.1016/j.dnarep.2011.04.021. Epub 2011 May 17.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Molecular cloning of a cell cycle regulation gene cyclin H from ischemic rat brain: expression in neurons after global cerebral ischemia.	Jin K, etal., J Neurochem 1999 Oct;73(4):1598-608.
5.	Analysis of candidate genes included in the mammary cancer susceptibility 1 (Mcs1) region.	Laes JF, etal., Mamm Genome 2001 Mar;12(3):199-206.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	Allelic imbalance and altered expression of genes in chromosome 2q11-2q16 from rat mammary gland carcinomas induced by 2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine.	Qiu C, etal., Oncogene. 2003 Feb 27;22(8):1253-60.
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Comprehensive gene review and curation	RGD comprehensive gene curation
14.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
15.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
16.	Temporal and spatial expression of cyclin H in rat spinal cord injury.	Wu G, etal., Neuromolecular Med. 2011 Sep;13(3):187-96. doi: 10.1007/s12017-011-8150-1. Epub 2011 Jun 28.

Additional References at PubMed

PMID:8692841	PMID:8692842	PMID:9852112	PMID:11319144	PMID:15489334	PMID:21778139	PMID:23393140	PMID:24855060

Genomics

Comparative Map Data

Ccnh
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	17,570,449 - 17,591,078 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	17,570,263 - 17,614,860 (+)	Ensembl				GRCr8
mRatBN7.2	2	15,835,064 - 15,855,648 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	15,834,833 - 15,855,819 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	22,936,030 - 22,956,622 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	21,036,283 - 21,056,875 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	15,710,083 - 15,730,675 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	13,593,100 - 13,613,910 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	13,593,100 - 13,613,910 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	13,446,659 - 13,467,469 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	14,179,894 - 14,200,704 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	12,100,804 - 12,121,614 (+)	NCBI		Celera
RGSC_v3.1	2	14,100,262 - 14,121,073 (+)	NCBI
Cytogenetic Map	2	q11	NCBI

CCNH
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	87,311,471 - 87,412,930 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	87,318,416 - 87,413,029 (-)	Ensembl			hg38	GRCh38
GRCh37	5	86,607,288 - 86,708,747 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	86,725,838 - 86,744,592 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	5	86,725,838 - 86,744,592	NCBI
Celera	5	82,582,332 - 82,601,086 (-)	NCBI		Celera
Cytogenetic Map	5	q14.3	NCBI
HuRef	5	81,894,247 - 81,913,020 (-)	NCBI		HuRef
CHM1_1	5	86,123,107 - 86,141,878 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	87,789,500 - 87,894,036 (-)	NCBI		T2T-CHM13v2.0

Ccnh
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	85,337,504 - 85,361,850 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	85,337,527 - 85,371,588 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	13	85,189,377 - 85,213,731 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	85,189,408 - 85,223,469 (+)	Ensembl			mm10	GRCm38
MGSCv37	13	85,329,082 - 85,353,328 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	13	85,662,587 - 85,686,833 (+)	NCBI		MGSCv36	mm8
Celera	13	87,421,607 - 87,445,967 (+)	NCBI		Celera
Cytogenetic Map	13	C3	NCBI
cM Map	13	45.05	NCBI

Ccnh
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955418	23,790,001 - 23,807,702 (+)	Ensembl
ChiLan1.0	NW_004955418	23,790,398 - 23,807,509 (+)	NCBI	ChiLan1.0	ChiLan1.0

CCNH
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	27,982,412 - 28,019,369 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	26,136,039 - 26,172,992 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	27,958,859 - 27,995,815 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	28,094,064 - 28,131,166 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	28,094,064 - 28,116,149 (+)	Ensembl			panPan2	panpan1.1

CCNH
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	21,046,477 - 21,067,305 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	21,046,472 - 21,178,315 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	22,412,153 - 22,431,889 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	20,955,126 - 20,974,862 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	20,955,145 - 20,976,993 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	20,926,297 - 20,945,993 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	20,888,786 - 20,908,786 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	21,180,551 - 21,200,143 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ccnh
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	176,673,557 - 176,690,580 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936469	5,935,131 - 5,952,460 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936469	5,933,163 - 5,952,190 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CCNH
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	94,980,941 - 95,018,634 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	2	94,980,938 - 95,019,053 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	97,505,024 - 97,539,020 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CCNH
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	4	81,373,812 - 81,392,454 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	4	81,373,994 - 81,392,326 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666049	30,376,461 - 30,412,792 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ccnh
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624743	6,883,114 - 6,902,745 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624743	6,883,124 - 6,902,518 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ccnh
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	210,844,063 - 210,865,228 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ccnh
229 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	85
Count of miRNA genes:	74
Interacting mature miRNAs:	79
Transcripts:	ENSRNOT00000049423
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578664	Bmd9	Bone mineral QTL density 9	5		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	2	5736325	50736325	Rat
1331764	Bp205	Blood pressure QTL 205	3.476		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	14368707	59368707	Rat
738010	Lnnr3	Liver neoplastic nodule remodeling QTL 3	2.94		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	2	1	42977529	Rat
9590080	Insglur4	Insulin/glucose ratio QTL 4	28.7	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	2	6152767	51152767	Rat
10755430	Coatc6	Coat color QTL 6		0.02576	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	13325041	58325041	Rat
1600379	Mcs18	Mammary carcinoma susceptibility QTL 18	2.6		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	9623581	44538110	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
1579916	Bp270	Blood pressure QTL 270		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	16051883	61051883	Rat
731166	Mamtr2	Mammary tumor resistance QTL 2		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	9623581	54623581	Rat
61368	Mcs1	Mammary carcinoma susceptibility QTL 1	4.4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	9623581	25054526	Rat
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	7605533	104774005	Rat

Markers in Region

RH130655

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	2	17,583,911 - 17,584,104 (+)	Marker Load Pipeline
mRatBN7.2	2	15,848,481 - 15,848,674 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	13,606,749 - 13,606,941	NCBI	Rnor6.0
Rnor_5.0	2	13,460,308 - 13,460,500	UniSTS	Rnor5.0
RGSC_v3.4	2	14,193,543 - 14,193,735	UniSTS	RGSC3.4
Celera	2	12,114,453 - 12,114,645	UniSTS
Cytogenetic Map	2	q12-q14	UniSTS

RH141924

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	15,851,030 - 15,851,210 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	13,609,298 - 13,609,477	NCBI	Rnor6.0
Rnor_5.0	2	13,462,857 - 13,463,036	UniSTS	Rnor5.0
RGSC_v3.4	2	14,196,092 - 14,196,271	UniSTS	RGSC3.4
Celera	2	12,117,002 - 12,117,181	UniSTS
Cytogenetic Map	2	q12-q14	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_052981	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039103265	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF154914	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ276495	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC059109	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473955	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000049423 ⟹ ENSRNOP00000039039

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	17,570,263 - 17,591,073 (+)	Ensembl
mRatBN7.2 Ensembl	2	15,834,833 - 15,855,643 (+)	Ensembl
Rnor_6.0 Ensembl	2	13,593,100 - 13,613,910 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000118807 ⟹ ENSRNOP00000084834

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	17,570,263 - 17,590,990 (+)	Ensembl
mRatBN7.2 Ensembl	2	15,834,833 - 15,855,819 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000133319 ⟹ ENSRNOP00000107330

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	17,570,263 - 17,614,860 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000155584 ⟹ ENSRNOP00000111122

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	17,570,263 - 17,605,703 (+)	Ensembl

RefSeq Acc Id:

NM_052981 ⟹ NP_443213

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	17,570,494 - 17,591,078 (+)	NCBI
mRatBN7.2	2	15,835,064 - 15,855,648 (+)	NCBI
Rnor_6.0	2	13,593,100 - 13,613,910 (+)	NCBI
Rnor_5.0	2	13,446,659 - 13,467,469 (+)	NCBI
RGSC_v3.4	2	14,179,894 - 14,200,704 (+)	RGD
Celera	2	12,100,804 - 12,121,614 (+)	RGD

Sequence:

show sequence

CGCATCCAGCACTTCCATTTTCCAATCAAGTCCCTCTCTCCACAGGTCCTGAAGTCCCTAGTGC
TCACGAGTCCTCGGGAACCAGGATCACTGCAGCCGCACCCACTTCTGACCGCTACCAGGCCACG
TCCGTCAGACTCCTCCCAAGCCTGGGAGCCCCGGGCAGACGCAGGCACGTGACCGTGACGTCAC
GCGCGCGCCTGCGGTCTGGGCCGAGGGTTCTCGCGTTGGCAGTCGCTCGTGGCTGCTGTCTCCC
GGAGTGTCGCTGTTTCTGTCTCGGCCCTGCGGCCCGTGAGGGTACAGCATGTACCACAACAGCA
GCCAGAAGCGGCACTGGACCTTCGCTAGCGAGGAGCAACTGGCGCGTCTGCGGGCCGACGCCAA
CCGCAAATTCAAGTGCAAAGCTGTGGCTAACGGGAAGGTTCTTCCAAATGATCCGTTGTTTCTT
GAGCCTCATGAAGAAATGACACTTTGCAAATACTATGAAAAAAGATTGTTGGAATTTTGTTCAG
TGTTTAAACCAGCTATGCCACGGTCTGTTGTGGGTACAGCTTGTATGTATTTCAAGCGTTTTTA
TCTTAATAACTCAGTAATGGAATATCACCCTCGGATAATAATGCTTACTTGTGCATTTTTGGCC
TGCAAAGTAGATGAATTCAATGTGTCTAGTCCTCAGAAAGAAGGGAACCTTCGAGAGAGTCCTC
TTGGACAGGAGAAGGCACTGGAACAGATTTTGGAATATGAACTACTACTTATACAACAACTTAA
TTTTCACCTCATTGTCCACAATCCATATAGACCATTTGAAGGCTTCCTCATTGATATAAAGACT
CGATACCCCATGTTGGAGAATCCAGAGATTTTGAGGAAAACGGCTGATGATTTTCTTAGTAGAA
TTGCATTGACAGATGCTTATCTTTTGTACACACCTTCACAAATTGCCCTGACTGCCATTTTATC
AAGAGCCTCTAGGGCTGGAATTACTATGGAAAGCTATTTATCAGAGAGTCTAATGCTGAAAGAG
AACAGAACTTGCCTGTCACAGCTACTGGATATAATGAAAAGCATGAGAAATCTAGTAAAAAAGT
ATGAGCCACCCAGATCTGAAGAAGTTGCTATTCTGAAACAGAAGTTGGAGCGATGTCATTCTTC
TGACCTTGCACTTAATATGGTTACAAAGAAGAGGAAAGGCTACGAAGACGATGACTATGTATCA
AAGAAACCCAAACAGGAAGAGGAGGAGTGGACGGACGATGACCTGGTAGATGCTCTCTAACCAG
TGTAAATGACTGCAGCAGTACTTACTGACCGACGGAAGTAGGAAGCATGTCTGACATTTTACTT
TTGTCAAAATAGTGCAATGTGAAAACATCAAAATATATTAAACTTTTCTAATTCTT

hide sequence

RefSeq Acc Id:

XM_039103265 ⟹ XP_038959193

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	17,570,449 - 17,589,514 (+)	NCBI
mRatBN7.2	2	15,835,065 - 15,854,084 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_443213	(Get FASTA)	NCBI Sequence Viewer
	XP_038959193	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD46521	(Get FASTA)	NCBI Sequence Viewer
	AAH59109	(Get FASTA)	NCBI Sequence Viewer
	CAC37406	(Get FASTA)	NCBI Sequence Viewer
	EDM09975	(Get FASTA)	NCBI Sequence Viewer
	EDM09976	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000039039
	ENSRNOP00000039039.1
GenBank Protein	Q9R1A0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_443213 ⟸ NM_052981

- UniProtKB:

Q9R1A0 (UniProtKB/Swiss-Prot), Q99JE5 (UniProtKB/Swiss-Prot), A6I4L7 (UniProtKB/TrEMBL), A0A8I6A2R2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MYHNSSQKRHWTFASEEQLARLRADANRKFKCKAVANGKVLPNDPLFLEPHEEMTLCKYYEKRL
LEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQKEGN
LRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDIKTRYPMLENPEILRKTAD
DFLSRIALTDAYLLYTPSQIALTAILSRASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMR
NLVKKYEPPRSEEVAILKQKLERCHSSDLALNMVTKKRKGYEDDDYVSKKPKQEEEEWTDDDLV
DAL

hide sequence

Ensembl Acc Id:

ENSRNOP00000039039 ⟸ ENSRNOT00000049423

RefSeq Acc Id:	XP_038959193 ⟸ XM_039103265
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000084834 ⟸ ENSRNOT00000118807

Ensembl Acc Id:

ENSRNOP00000111122 ⟸ ENSRNOT00000155584

Ensembl Acc Id:

ENSRNOP00000107330 ⟸ ENSRNOT00000133319

Protein Domains

Cyclin-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9R1A0-F1-model_v2	AlphaFold	Q9R1A0	1-323	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691049

Promoter ID:

EPDNEW_R1574

Type:

initiation region

Name:

Ccnh_1

Description:

cyclin H

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	13,593,387 - 13,593,447	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69419	AgrOrtholog
BioCyc Gene	G2FUF-54931	BioCyc
Ensembl Genes	ENSRNOG00000031656	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000049423	ENTREZGENE
	ENSRNOT00000049423.2	UniProtKB/Swiss-Prot
Gene3D-CATH	Cyclin-like	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:6886953	IMAGE-MGC_LOAD
InterPro	Cyclin-like	UniProtKB/Swiss-Prot
	Cyclin-like_sf	UniProtKB/Swiss-Prot
	Cyclin/Ssn8	UniProtKB/Swiss-Prot
	Cyclin_C_2	UniProtKB/Swiss-Prot
	Cyclin_N	UniProtKB/Swiss-Prot
	CyclinH/Ccl1	UniProtKB/Swiss-Prot
KEGG Report	rno:84389	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72647	IMAGE-MGC_LOAD
NCBI Gene	84389	ENTREZGENE
PANTHER	PTHR10026	UniProtKB/Swiss-Prot
Pfam	Cyclin_C_2	UniProtKB/Swiss-Prot
	Cyclin_N	UniProtKB/Swiss-Prot
PhenoGen	Ccnh	PhenoGen
RatGTEx	ENSRNOG00000031656	RatGTEx
SMART	CYCLIN	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47954	UniProtKB/Swiss-Prot
TIGR	TC231118
UniProt	A0A8I6A2R2	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LQQ7_RAT	UniProtKB/TrEMBL
	A0ABK0LX54_RAT	UniProtKB/TrEMBL
	A6I4L7	ENTREZGENE, UniProtKB/TrEMBL
	A6I4L8_RAT	UniProtKB/TrEMBL
	CCNH_RAT	UniProtKB/Swiss-Prot
	Q99JE5	ENTREZGENE
	Q9R1A0	ENTREZGENE
UniProt Secondary	Q99JE5	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Ccnh	cyclin H			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in normal postmitotic neurons	69371
gene_process	controls cell cycle	68725
gene_process	controls cell cycle	69371
gene_regulation	expression is increased in surviving neurons that are ischemic	69371

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)