Symbol:
Msln
Name:
mesothelin
RGD ID:
69333
Description:
Involved in pancreas development. Located in cell surface and extracellular space. Human ortholog(s) of this gene implicated in ovarian cancer; pancreas disease; pancreatic cancer; and pancreatic ductal carcinoma. Orthologous to human MSLN (mesothelin); INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
ERC/mesothelin; pre-pro-megakaryocyte-potentiating factor; protein expressed in renal carcinoma
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MSLN (mesothelin) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Msln (mesothelin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MSLN (mesothelin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
LOC611363 (mesothelin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
LOC100524016 (mesothelin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MSLN (mesothelin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Msln (mesothelin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Msln (mesothelin)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
MSLN (mesothelin)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 15,276,489 - 15,285,921 (-) NCBI GRCr8 mRatBN7.2 10 14,771,946 - 14,781,382 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 14,771,961 - 14,777,643 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 19,511,024 - 19,516,683 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 18,999,901 - 19,005,560 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 14,500,155 - 14,505,826 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 15,119,700 - 15,129,129 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 15,119,663 - 15,125,408 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 14,932,441 - 14,941,855 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 15,017,162 - 15,022,823 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 15,017,161 - 15,022,823 (-) NCBI Celera 10 14,441,324 - 14,446,985 (-) NCBI Celera Cytogenetic Map 10 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Msln Rat 1,2-dichloroethane decreases expression ISO Msln (Mus musculus) 6480464 ethylene dichloride results in decreased expression of MSLN mRNA CTD PMID:28960355 Msln Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of MSLN mRNA CTD PMID:30723492 Msln Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of MSLN mRNA CTD PMID:17557909 Msln Rat 17beta-estradiol multiple interactions ISO MSLN (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of MSLN mRNA CTD PMID:30165855 Msln Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of MSLN mRNA CTD PMID:32145629 Msln Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of MSLN mRNA CTD PMID:32741896 Msln Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of MSLN mRNA CTD PMID:32741896 Msln Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Msln (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MSLN mRNA CTD PMID:21570461 Msln Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MSLN mRNA CTD PMID:33387578 Msln Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of MSLN mRNA CTD PMID:34747641 Msln Rat 2,4-diaminotoluene increases expression ISO Msln (Mus musculus) 6480464 2 and 4-diaminotoluene results in increased expression of MSLN mRNA CTD PMID:20713471 Msln Rat 2,6-dimethoxyphenol multiple interactions ISO MSLN (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of MSLN protein CTD PMID:38598786 Msln Rat 2-nitrotoluene increases expression EXP 6480464 2-nitrotoluene results in increased expression of MSLN mRNA CTD PMID:16460773 Msln Rat 3,4-methylenedioxymethamphetamine increases expression ISO Msln (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of MSLN mRNA CTD PMID:26251327 Msln Rat 3-methylcholanthrene increases expression ISO Msln (Mus musculus) 6480464 Methylcholanthrene results in increased expression of MSLN mRNA CTD PMID:20713471 Msln Rat 4,4'-sulfonyldiphenol increases expression ISO Msln (Mus musculus) 6480464 bisphenol S results in increased expression of MSLN mRNA CTD PMID:30951980 Msln Rat 4-hydroxyphenyl retinamide decreases expression ISO Msln (Mus musculus) 6480464 Fenretinide results in decreased expression of MSLN mRNA CTD PMID:28973697 Msln Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of MSLN mRNA CTD PMID:24780913 Msln Rat aflatoxin B1 decreases methylation ISO MSLN (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of MSLN gene CTD PMID:27153756 Msln Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of MSLN mRNA CTD PMID:16483693 Msln Rat amphibole asbestos increases expression EXP 6480464 Asbestos and Amphibole results in increased expression of MSLN mRNA CTD PMID:22251266 Msln Rat arsenite(3-) increases expression ISO Msln (Mus musculus) 6480464 arsenite results in increased expression of MSLN protein CTD PMID:37955338 Msln Rat asbestos increases expression ISO MSLN (Homo sapiens) 6480464 Asbestos results in increased expression of MSLN protein and Asbestos results in increased expression of MSLN protein modified form CTD PMID:19190155 and PMID:27032653 Msln Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of MSLN mRNA CTD PMID:36841081 Msln Rat benzo[a]pyrene increases expression ISO Msln (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of MSLN mRNA CTD PMID:20713471 Msln Rat benzo[a]pyrene affects methylation ISO MSLN (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of MSLN promoter CTD PMID:27901495 Msln Rat benzo[a]pyrene decreases methylation ISO MSLN (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of MSLN 5' UTR CTD PMID:27901495 Msln Rat benzo[a]pyrene multiple interactions ISO Msln (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of MSLN mRNA and [corannulene co-treated with Benzo(a)pyrene] results in increased expression of MSLN mRNA CTD PMID:27858113 and PMID:32417428 Msln Rat benzo[b]fluoranthene increases expression ISO Msln (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of MSLN mRNA CTD PMID:26377693 Msln Rat benzo[b]fluoranthene multiple interactions ISO Msln (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of MSLN mRNA CTD PMID:27858113 Msln Rat bis(2-ethylhexyl) phthalate decreases expression ISO MSLN (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of MSLN mRNA CTD PMID:31163220 Msln Rat bisphenol A increases expression ISO Msln (Mus musculus) 6480464 bisphenol A results in increased expression of MSLN mRNA CTD PMID:23798566 more ... Msln Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MSLN mRNA CTD PMID:32145629 Msln Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of MSLN gene CTD PMID:28505145 Msln Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of MSLN mRNA CTD PMID:25181051 Msln Rat bisphenol F increases expression ISO Msln (Mus musculus) 6480464 bisphenol F results in increased expression of MSLN mRNA CTD PMID:30951980 Msln Rat bisphenol F decreases expression ISO Msln (Mus musculus) 6480464 bisphenol F results in decreased expression of MSLN mRNA CTD PMID:36706583 Msln Rat bromochloroacetic acid increases expression EXP 6480464 bromochloroacetic acid results in increased expression of MSLN mRNA CTD PMID:16460773 Msln Rat cadmium atom multiple interactions ISO Msln (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of MSLN mRNA CTD PMID:37325564 Msln Rat cadmium dichloride multiple interactions ISO Msln (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of MSLN mRNA CTD PMID:37325564 Msln Rat carbon nanotube increases expression ISO Msln (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of MSLN mRNA CTD PMID:25554681 Msln Rat carbon nanotube affects expression ISO Msln (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of MSLN mRNA CTD PMID:25554681 Msln Rat carbon nanotube decreases expression ISO Msln (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of MSLN mRNA CTD PMID:25620056 Msln Rat chlordecone increases expression ISO Msln (Mus musculus) 6480464 Chlordecone results in increased expression of MSLN mRNA CTD PMID:33711761 Msln Rat chloroprene decreases expression EXP 6480464 Chloroprene results in decreased expression of MSLN mRNA CTD PMID:23125180 Msln Rat choline multiple interactions ISO Msln (Mus musculus) 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression of MSLN mRNA CTD PMID:29127188 Msln Rat chrysene multiple interactions ISO Msln (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of MSLN mRNA CTD PMID:27858113 Msln Rat cisplatin decreases expression ISO MSLN (Homo sapiens) 6480464 Cisplatin results in decreased expression of MSLN mRNA CTD PMID:27392435 Msln Rat copper(II) chloride decreases expression ISO MSLN (Homo sapiens) 6480464 cupric chloride results in decreased expression of MSLN mRNA CTD PMID:38568856 Msln Rat crocidolite asbestos increases expression ISO Msln (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of MSLN mRNA CTD PMID:29507420 Msln Rat DDE decreases expression ISO MSLN (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of MSLN mRNA CTD PMID:38568856 Msln Rat diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of MSLN mRNA CTD PMID:21658437 Msln Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of MSLN mRNA CTD PMID:21551480 and PMID:25152437 Msln Rat folic acid multiple interactions ISO Msln (Mus musculus) 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression of MSLN mRNA CTD PMID:29127188 Msln Rat furan increases expression EXP 6480464 furan results in increased expression of MSLN mRNA CTD PMID:27387713 Msln Rat furfural multiple interactions ISO MSLN (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of MSLN protein and [Sodium Chloride co-treated with Furaldehyde] results in increased expression of MSLN protein CTD PMID:38598786 Msln Rat gemcitabine multiple interactions EXP 6480464 Gemcitabine results in decreased expression of and results in decreased secretion of MSLN protein alternative form CTD PMID:25347530 Msln Rat genistein increases expression ISO Msln (Mus musculus) 6480464 Genistein results in increased expression of MSLN mRNA CTD PMID:32186404 Msln Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of MSLN mRNA CTD PMID:33387578 Msln Rat glyphosate decreases expression EXP 6480464 Glyphosate results in decreased expression of MSLN mRNA CTD PMID:38314887 Msln Rat Indeno[1,2,3-cd]pyrene decreases expression ISO Msln (Mus musculus) 6480464 indeno(1 more ... CTD PMID:26377693 Msln Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of MSLN mRNA CTD PMID:21396975 Msln Rat L-methionine multiple interactions ISO Msln (Mus musculus) 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression of MSLN mRNA CTD PMID:29127188 Msln Rat lead diacetate decreases expression ISO MSLN (Homo sapiens) 6480464 lead acetate results in decreased expression of MSLN mRNA CTD PMID:38568856 Msln Rat methotrexate affects response to substance ISO MSLN (Homo sapiens) 6480464 MSLN protein affects the susceptibility to Methotrexate CTD PMID:16217747 Msln Rat methylparaben decreases expression ISO MSLN (Homo sapiens) 6480464 methylparaben results in decreased expression of MSLN mRNA CTD PMID:38568856 Msln Rat microcystin-LR multiple interactions EXP 6480464 [Dietary Fats co-treated with Cholesterol and Dietary co-treated with cyanoginosin LR] results in increased expression of MSLN mRNA CTD PMID:34740672 Msln Rat microcystin-LR increases expression EXP 6480464 cyanoginosin LR results in increased expression of MSLN mRNA CTD PMID:34740672 Msln Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of MSLN mRNA CTD PMID:28943392 Msln Rat nickel sulfate decreases expression ISO MSLN (Homo sapiens) 6480464 nickel sulfate results in decreased expression of MSLN mRNA CTD PMID:22714537 Msln Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of MSLN mRNA CTD PMID:33484710 Msln Rat ochratoxin A increases expression ISO MSLN (Homo sapiens) 6480464 ochratoxin A results in increased expression of MSLN mRNA CTD PMID:29098329 Msln Rat ochratoxin A increases acetylation ISO MSLN (Homo sapiens) 6480464 ochratoxin A results in increased acetylation of MSLN promoter CTD PMID:29098329 Msln Rat ochratoxin A multiple interactions ISO MSLN (Homo sapiens) 6480464 [ochratoxin A results in increased acetylation of MSLN promoter] which results in increased expression of MSLN mRNA CTD PMID:29098329 Msln Rat omega-6 fatty acid increases expression ISO MSLN (Homo sapiens) 6480464 Fatty Acids and Omega-6 results in increased expression of MSLN mRNA CTD PMID:16823509 Msln Rat ozone increases expression ISO Msln (Mus musculus) 6480464 Ozone results in increased expression of MSLN mRNA CTD PMID:12763052 Msln Rat ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of MSLN mRNA CTD PMID:37871705 Msln Rat perfluorohexanesulfonic acid increases expression ISO Msln (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of MSLN mRNA CTD PMID:37995155 Msln Rat phorbol 13-acetate 12-myristate multiple interactions ISO MSLN (Homo sapiens) 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of MSLN mRNA CTD PMID:16979875 Msln Rat potassium chromate decreases expression ISO MSLN (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of MSLN mRNA CTD PMID:22714537 Msln Rat progesterone increases expression ISO MSLN (Homo sapiens) 6480464 Progesterone results in increased expression of MSLN mRNA CTD PMID:17404688 Msln Rat serpentine asbestos increases expression EXP 6480464 Asbestos and Serpentine results in increased expression of MSLN protein CTD PMID:20933535 Msln Rat silicon dioxide decreases expression EXP 6480464 Silicon Dioxide results in decreased expression of MSLN mRNA CTD PMID:22431001 Msln Rat silver atom increases expression ISO Msln (Mus musculus) 6480464 Silver results in increased expression of MSLN mRNA CTD PMID:27131904 Msln Rat silver(0) increases expression ISO Msln (Mus musculus) 6480464 Silver results in increased expression of MSLN mRNA CTD PMID:27131904 Msln Rat sodium arsenate decreases expression ISO Msln (Mus musculus) 6480464 sodium arsenate results in decreased expression of MSLN mRNA CTD PMID:21795629 Msln Rat sodium arsenite decreases expression ISO MSLN (Homo sapiens) 6480464 sodium arsenite results in decreased expression of MSLN mRNA CTD PMID:22714537 and PMID:38568856 Msln Rat sodium arsenite decreases expression ISO Msln (Mus musculus) 6480464 sodium arsenite results in decreased expression of MSLN mRNA CTD PMID:37682722 Msln Rat sodium arsenite increases expression ISO MSLN (Homo sapiens) 6480464 sodium arsenite results in increased expression of MSLN mRNA CTD PMID:24570342 Msln Rat sodium arsenite decreases methylation ISO MSLN (Homo sapiens) 6480464 sodium arsenite results in decreased methylation of MSLN gene CTD PMID:24570342 Msln Rat sodium chloride multiple interactions ISO MSLN (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of MSLN protein more ... CTD PMID:38598786 Msln Rat Soman increases expression EXP 6480464 Soman results in increased expression of MSLN mRNA CTD PMID:19281266 Msln Rat streptozocin multiple interactions ISO Msln (Mus musculus) 6480464 [Streptozocin co-treated with Dietary Fats] results in increased expression of MSLN mRNA CTD PMID:29127188 Msln Rat tacrolimus hydrate increases expression ISO Msln (Mus musculus) 6480464 Tacrolimus results in increased expression of MSLN mRNA CTD PMID:29362864 Msln Rat temozolomide increases expression ISO MSLN (Homo sapiens) 6480464 Temozolomide results in increased expression of MSLN mRNA CTD PMID:31758290 Msln Rat tert-butyl hydroperoxide decreases expression ISO MSLN (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of MSLN mRNA CTD PMID:15336504 Msln Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of MSLN mRNA CTD PMID:32741896 Msln Rat tetraphene decreases expression ISO Msln (Mus musculus) 6480464 benz(a)anthracene results in decreased expression of MSLN mRNA CTD PMID:26377693 Msln Rat tetraphene multiple interactions ISO Msln (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of MSLN mRNA CTD PMID:27858113 Msln Rat thapsigargin increases expression ISO Msln (Mus musculus) 6480464 Thapsigargin results in increased expression of MSLN protein CTD PMID:24648495 Msln Rat thioacetamide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of MSLN mRNA CTD PMID:28943392 Msln Rat titanium dioxide increases expression ISO Msln (Mus musculus) 6480464 titanium dioxide results in increased expression of MSLN mRNA CTD PMID:27760801 Msln Rat titanium dioxide affects expression ISO Msln (Mus musculus) 6480464 titanium dioxide affects the expression of MSLN mRNA CTD PMID:17656681 and PMID:23557971 Msln Rat triclosan increases expression ISO MSLN (Homo sapiens) 6480464 Triclosan results in increased expression of MSLN mRNA CTD PMID:30510588 Msln Rat troglitazone increases expression ISO MSLN (Homo sapiens) 6480464 troglitazone results in increased expression of MSLN mRNA CTD PMID:19140230 Msln Rat urethane increases expression ISO MSLN (Homo sapiens) 6480464 Urethane results in increased expression of MSLN mRNA CTD PMID:28818685 Msln Rat valproic acid affects expression ISO Msln (Mus musculus) 6480464 Valproic Acid affects the expression of MSLN mRNA CTD PMID:17292431 Msln Rat valproic acid increases methylation ISO MSLN (Homo sapiens) 6480464 Valproic Acid results in increased methylation of MSLN gene CTD PMID:29154799 Msln Rat zinc atom multiple interactions ISO MSLN (Homo sapiens) 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of MSLN mRNA CTD PMID:16979875 Msln Rat zinc(0) multiple interactions ISO MSLN (Homo sapiens) 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of MSLN mRNA CTD PMID:16979875
1,2-dichloroethane (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-diaminotoluene (ISO) 2,6-dimethoxyphenol (ISO) 2-nitrotoluene (EXP) 3,4-methylenedioxymethamphetamine (ISO) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) ammonium chloride (EXP) amphibole asbestos (EXP) arsenite(3-) (ISO) asbestos (ISO) atrazine (EXP) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bromochloroacetic acid (EXP) cadmium atom (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) chlordecone (ISO) chloroprene (EXP) choline (ISO) chrysene (ISO) cisplatin (ISO) copper(II) chloride (ISO) crocidolite asbestos (ISO) DDE (ISO) diethylstilbestrol (EXP) diuron (EXP) folic acid (ISO) furan (EXP) furfural (ISO) gemcitabine (EXP) genistein (ISO) gentamycin (EXP) glyphosate (EXP) Indeno[1,2,3-cd]pyrene (ISO) indole-3-methanol (EXP) L-methionine (ISO) lead diacetate (ISO) methotrexate (ISO) methylparaben (ISO) microcystin-LR (EXP) N-nitrosodiethylamine (EXP) nickel sulfate (ISO) nitrofen (EXP) ochratoxin A (ISO) omega-6 fatty acid (ISO) ozone (EXP,ISO) perfluorohexanesulfonic acid (ISO) phorbol 13-acetate 12-myristate (ISO) potassium chromate (ISO) progesterone (ISO) serpentine asbestos (EXP) silicon dioxide (EXP) silver atom (ISO) silver(0) (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium chloride (ISO) Soman (EXP) streptozocin (ISO) tacrolimus hydrate (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) testosterone (EXP) tetraphene (ISO) thapsigargin (ISO) thioacetamide (EXP) titanium dioxide (ISO) triclosan (ISO) troglitazone (ISO) urethane (ISO) valproic acid (ISO) zinc atom (ISO) zinc(0) (ISO)
1.
Control of human mesothelin-expressing tumors by DNA vaccines.
Chang CL, etal., Gene Ther. 2007 Aug;14(16):1189-98. Epub 2007 Jun 21.
2.
An animal model of preclinical diagnosis of pancreatic ductal adenocarcinomas.
Fukamachi K, etal., Biochem Biophys Res Commun. 2009 Dec 18;390(3):636-41. Epub 2009 Oct 8.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Establishment of a novel specific ELISA system for rat N- and C-ERC/mesothelin. Rat ERC/mesothelin in the body fluids of mice bearing mesothelioma.
Hagiwara Y, etal., Cancer Sci. 2008 Apr;99(4):666-70. Epub 2008 Feb 24.
5.
Mesothelin is overexpressed in pancreaticobiliary adenocarcinomas but not in normal pancreas and chronic pancreatitis.
Hassan R, etal., Am J Clin Pathol. 2005 Dec;124(6):838-45.
6.
Phase I study of SS1P, a recombinant anti-mesothelin immunotoxin given as a bolus I.V. infusion to patients with mesothelin-expressing mesothelioma, ovarian, and pancreatic cancers.
Hassan R, etal., Clin Cancer Res. 2007 Sep 1;13(17):5144-9.
7.
Expression and localization of mesothelin in developing rat pancreas.
Hou LQ, etal., Dev Growth Differ. 2008 Sep;50(7):531-41.
8.
Biomarkers in Diagnosis of pancreatic carcinoma in fine-needle aspirates.
Jhala N, etal., Am J Clin Pathol. 2006 Oct;126(4):572-9.
9.
Circulating mesothelin protein and cellular antimesothelin immunity in patients with pancreatic cancer.
Johnston FM, etal., Clin Cancer Res. 2009 Nov 1;15(21):6511-8. Epub 2009 Oct 20.
10.
Mesothelin is a malignant factor and therapeutic vaccine target for pancreatic cancer.
Li M, etal., Mol Cancer Ther. 2008 Feb;7(2):286-96.
11.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
12.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.
GOA pipeline
RGD automated data pipeline
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
Comprehensive gene review and curation
RGD comprehensive gene curation
16.
Frequent hypomethylation of multiple genes overexpressed in pancreatic ductal adenocarcinoma.
Sato N, etal., Cancer Res. 2003 Jul 15;63(14):4158-66.
17.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
18.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
19.
Mapping and determination of the cDNA sequence of the Erc gene preferentially expressed in renal cell carcinoma in the Tsc2 gene mutant (Eker) rat model.
Yamashita Y, etal., Biochem Biophys Res Commun 2000 Aug 18;275(1):134-40.
20.
S100A4 protein and mesothelin expression in dysplasia and carcinoma of the extrahepatic bile duct.
Zhao H, etal., Am J Clin Pathol. 2007 Mar;127(3):374-9.
Msln Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 15,276,489 - 15,285,921 (-) NCBI GRCr8 mRatBN7.2 10 14,771,946 - 14,781,382 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 14,771,961 - 14,777,643 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 19,511,024 - 19,516,683 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 18,999,901 - 19,005,560 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 14,500,155 - 14,505,826 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 15,119,700 - 15,129,129 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 15,119,663 - 15,125,408 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 14,932,441 - 14,941,855 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 15,017,162 - 15,022,823 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 15,017,161 - 15,022,823 (-) NCBI Celera 10 14,441,324 - 14,446,985 (-) NCBI Celera Cytogenetic Map 10 q12 NCBI
MSLN Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 760,734 - 768,865 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 760,734 - 768,865 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 810,734 - 818,865 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 751,134 - 758,866 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 750,797 - 758,866 NCBI Celera 16 1,010,640 - 1,018,740 (+) NCBI Celera Cytogenetic Map 16 p13.3 NCBI HuRef 16 732,923 - 740,842 (+) NCBI HuRef CHM1_1 16 810,267 - 818,805 (+) NCBI CHM1_1 T2T-CHM13v2.0 16 764,710 - 773,383 (+) NCBI T2T-CHM13v2.0
Msln Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 25,967,587 - 25,973,352 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 25,967,587 - 25,973,352 (-) Ensembl GRCm39 Ensembl GRCm38 17 25,748,613 - 25,754,378 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 25,748,613 - 25,754,378 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 25,885,558 - 25,891,272 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 25,476,213 - 25,481,927 (-) NCBI MGSCv36 mm8 Celera 17 26,280,944 - 26,286,658 (-) NCBI Celera Cytogenetic Map 17 A3.3 NCBI cM Map 17 12.85 NCBI
MSLN Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 1,003,978 - 1,010,342 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 4,787,991 - 4,794,343 (+) NCBI NHGRI_mPanPan1 PanPan1.1 16 775,433 - 783,449 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 777,146 - 783,449 (+) Ensembl panpan1.1 panPan2
LOC611363 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 39,827,985 - 39,834,945 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 41,092,644 - 41,096,610 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 40,171,101 - 40,175,067 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 6 39,859,730 - 39,863,696 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 39,819,938 - 39,823,904 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 40,298,820 - 40,302,786 (-) NCBI UU_Cfam_GSD_1.0
LOC100524016
MSLN
Msln
.
Predicted Target Of
Count of predictions: 104 Count of miRNA genes: 79 Interacting mature miRNAs: 87 Transcripts: ENSRNOT00000026395 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 2313066 Bss63 Bone structure and strength QTL 63 1.4 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 10 5387014 50387014 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 2313064 Bmd71 Bone mineral density QTL 71 0.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 10 5387014 50387014 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 634329 Pia15 Pristane induced arthritis QTL 15 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 1 24158324 Rat 1578761 Stresp21 Stress response QTL 21 3.3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 6375746 51375746 Rat 2293680 Bss40 Bone structure and strength QTL 40 5.66 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 10 1 35225947 Rat 7387235 Uae41 Urinary albumin excretion QTL 41 5.26 0.1874 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 10 1 29497586 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 10401803 Kidm50 Kidney mass QTL 50 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 10 418344 45418344 Rat 737820 Alc9 Alcohol consumption QTL 9 2.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 10 5144027 19233348 Rat 2313081 Bss64 Bone structure and strength QTL 64 1.3 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 10 5387014 50387014 Rat 631828 Alc5 Alcohol consumption QTL 5 2.4 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 10 5144027 17245662 Rat 634327 Hc4 Hypercalciuria QTL 4 2.4 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 10 1 38328221 Rat 2313095 Bss62 Bone structure and strength QTL 62 1.5 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 631660 Hcar1 Hepatocarcinoma resistance QTL 1 3.4 0.0001 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 10 6154182 15990232 Rat 1576304 Schws7 Schwannoma susceptibility QTL 7 0.0115 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 4765527 19816042 Rat 7411611 Foco17 Food consumption QTL 17 18.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 1 42315980 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 2313104 Bss61 Bone structure and strength QTL 61 0.9 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat
BE099462
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 14,771,980 - 14,772,159 (+) MAPPER mRatBN7.2 Rnor_6.0 10 15,119,735 - 15,119,913 NCBI Rnor6.0 Rnor_5.0 10 14,932,456 - 14,932,634 UniSTS Rnor5.0 RGSC_v3.4 10 15,017,170 - 15,017,348 UniSTS RGSC3.4 Celera 10 14,441,332 - 14,441,510 UniSTS RH 3.4 Map 10 154.3 UniSTS Cytogenetic Map 10 q12-q21 UniSTS Cytogenetic Map 10 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
49
86
91
90
59
25
59
6
217
96
66
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000026395 ⟹ ENSRNOP00000026395
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 14,771,961 - 14,777,643 (-) Ensembl Rnor_6.0 Ensembl 10 15,119,663 - 15,125,408 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000102692 ⟹ ENSRNOP00000077428
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 14,771,961 - 14,777,643 (-) Ensembl
RefSeq Acc Id:
NM_031658 ⟹ NP_113846
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 15,276,490 - 15,282,153 (-) NCBI mRatBN7.2 10 14,771,973 - 14,777,636 (-) NCBI Rnor_6.0 10 15,119,727 - 15,125,388 (-) NCBI Rnor_5.0 10 14,932,441 - 14,941,855 (-) NCBI RGSC_v3.4 10 15,017,162 - 15,022,823 (-) RGD Celera 10 14,441,324 - 14,446,985 (-) RGD
Sequence:
TGCCAACAGGCCCCTCACTGTGTCCAAACAGTGGTGTGAGTTGAGGGGTGGGACAGGTGGGGACCTCAGAACCATTGTTATCCACAGACCATGGCCTTGCCAACAGCCCAACCCCTGCTGGGGTCCTG
hide sequence
RefSeq Acc Id:
XM_006246022 ⟹ XP_006246084
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 15,276,489 - 15,285,921 (-) NCBI mRatBN7.2 10 14,771,946 - 14,781,382 (-) NCBI Rnor_6.0 10 15,119,700 - 15,129,129 (-) NCBI Rnor_5.0 10 14,932,441 - 14,941,855 (-) NCBI
Sequence:
TGGGAGCTGTGTAAACTCAGTTCTGCAAACAGAAGGTTTCTGTAGACCATGGCCTTGCCAACAG
hide sequence
RefSeq Acc Id:
NP_113846 ⟸ NM_031658
- Peptide Label:
precursor
- UniProtKB:
A0A8L2QE96 (UniProtKB/TrEMBL)
- Sequence:
MALPTAQPLLGSCGSPICSRSFLLLLLSLGWLPLLQTQTTRTSQEAALLHAVTGTVDFASLPTGLFLGLTCDEVSGLSMGHAKELAMAVRQKNIVLQVHQLRCLARRLPKHLTNEELDALPLDLLLFL
hide sequence
RefSeq Acc Id:
XP_006246084 ⟸ XM_006246022
- Peptide Label:
isoform X1
- UniProtKB:
Q6IRG1 (UniProtKB/Swiss-Prot), Q9ERA7 (UniProtKB/Swiss-Prot), A6HD44 (UniProtKB/TrEMBL), A0A8L2QE96 (UniProtKB/TrEMBL)
- Sequence:
MALPTAQPLLGSCGSPICSRSFLLLLLSLGWLPLLQTQTTRTSQEAALLHAVTGTVDFASLPTGLFLGLMCDEVSGLSMGHAKELAMAVRQKNIVLQVHQLRCLARRLPKHLTNEELDALPLDLLLFL
hide sequence
Ensembl Acc Id:
ENSRNOP00000026395 ⟸ ENSRNOT00000026395
Ensembl Acc Id:
ENSRNOP00000077428 ⟸ ENSRNOT00000102692
RGD ID: 13697055 Promoter ID: EPDNEW_R7580 Type: initiation region Name: Msln_1 Description: mesothelin SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 15,125,418 - 15,125,478 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Msln
mesothelin
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_expression
overexpressed in primary renal carcinomas (RCs)
68817
gene_homology
56.1% amino acid identity to human homolog
68817
