Symbol:
Mogs
Name:
mannosyl-oligosaccharide glucosidase
RGD ID:
69240
Description:
Predicted to enable Glc3Man9GlcNAc2 oligosaccharide glucosidase activity. Predicted to be involved in protein N-linked glycosylation. Predicted to be located in endoplasmic reticulum. Predicted to be active in endoplasmic reticulum membrane. Human ortholog(s) of this gene implicated in congenital disorder of glycosylation type IIb. Orthologous to human MOGS (mannosyl-oligosaccharide glucosidase); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; ammonium chloride.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Gcs1; glucosidase 1; glycoprotein-processing glucosidase I; LOC103692171
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 117,179,335 - 117,182,738 (+) NCBI GRCr8 mRatBN7.2 4 115,621,623 - 115,625,026 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 115,621,623 - 115,625,032 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 121,098,230 - 121,101,633 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 116,873,422 - 116,876,825 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 115,487,997 - 115,491,399 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 113,948,328 - 113,951,731 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 113,948,514 - 113,951,847 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 178,633,399 - 178,636,802 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 117,327,609 - 117,331,012 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 117,572,089 - 117,575,493 (+) NCBI Celera 4 104,615,822 - 104,619,225 (+) NCBI Celera Cytogenetic Map 4 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mogs Rat (1->4)-beta-D-glucan multiple interactions ISO Mogs (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of MOGS mRNA CTD PMID:36331819 Mogs Rat 1,2-dimethylhydrazine increases expression ISO Mogs (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of MOGS mRNA CTD PMID:22206623 Mogs Rat 1,2-dimethylhydrazine multiple interactions ISO Mogs (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of MOGS mRNA] CTD PMID:22206623 Mogs Rat 17alpha-ethynylestradiol multiple interactions ISO Mogs (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MOGS mRNA CTD PMID:17942748 Mogs Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Mogs (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Mogs Rat 2,3,7,8-tetrachlorodibenzodioxine decreases methylation ISO Mogs (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased methylation of MOGS gene CTD PMID:21212295 Mogs Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Mogs (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MOGS mRNA CTD PMID:21570461 Mogs Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MOGS mRNA CTD PMID:32109520 and PMID:33387578 Mogs Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Mogs (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MOGS mRNA and [Tetrachlorodibenzodioxin co-treated with Lipopolysaccharides] results in decreased methylation of MOGS gene CTD PMID:17942748 and PMID:21212295 Mogs Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of MOGS mRNA CTD PMID:21346803 Mogs Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO MOGS (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of MOGS mRNA CTD PMID:28628672 Mogs Rat 4,4'-sulfonyldiphenol multiple interactions ISO MOGS (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of MOGS mRNA CTD PMID:28628672 Mogs Rat 4,4'-sulfonyldiphenol increases expression ISO MOGS (Homo sapiens) 6480464 bisphenol S results in increased expression of MOGS protein CTD PMID:34186270 Mogs Rat acrolein multiple interactions ISO MOGS (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of and results in increased oxidation of MOGS mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of and results in increased oxidation of MOGS mRNA CTD PMID:32699268 Mogs Rat acrylamide decreases expression ISO MOGS (Homo sapiens) 6480464 Acrylamide results in decreased expression of MOGS mRNA CTD PMID:32763439 Mogs Rat all-trans-retinoic acid decreases expression ISO Mogs (Mus musculus) 6480464 Tretinoin results in decreased expression of MOGS mRNA CTD PMID:16604517 Mogs Rat alpha-pinene multiple interactions ISO MOGS (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of and results in increased oxidation of MOGS mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of and results in increased oxidation of MOGS mRNA CTD PMID:32699268 Mogs Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of MOGS mRNA CTD PMID:16483693 Mogs Rat arsane multiple interactions ISO MOGS (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of MOGS mRNA CTD PMID:39836092 Mogs Rat arsenic atom multiple interactions ISO MOGS (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of MOGS mRNA CTD PMID:39836092 Mogs Rat benzo[a]pyrene increases expression ISO Mogs (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of MOGS mRNA CTD PMID:22228805 Mogs Rat benzo[a]pyrene diol epoxide I decreases expression ISO MOGS (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Mogs Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MOGS mRNA CTD PMID:25181051 Mogs Rat bisphenol A increases expression ISO MOGS (Homo sapiens) 6480464 bisphenol A results in increased expression of MOGS protein CTD PMID:37567409 Mogs Rat bisphenol A increases expression ISO Mogs (Mus musculus) 6480464 bisphenol A results in increased expression of MOGS mRNA CTD PMID:33221593 Mogs Rat bisphenol AF increases expression ISO MOGS (Homo sapiens) 6480464 bisphenol AF results in increased expression of MOGS protein CTD PMID:34186270 Mogs Rat Bisphenol B increases expression ISO MOGS (Homo sapiens) 6480464 bisphenol B results in increased expression of MOGS protein CTD PMID:34186270 Mogs Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of MOGS mRNA CTD PMID:31077537 Mogs Rat cadmium dichloride decreases expression ISO MOGS (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of MOGS mRNA CTD PMID:38568856 Mogs Rat cadmium dichloride multiple interactions EXP 6480464 [Cadmium Chloride co-treated with diallyl disulfide] results in increased expression of MOGS mRNA CTD PMID:31077537 Mogs Rat carbon nanotube increases expression ISO Mogs (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of MOGS mRNA CTD PMID:25554681 Mogs Rat CGP 52608 multiple interactions ISO MOGS (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to GCS1 gene] CTD PMID:28238834 Mogs Rat chlorpyrifos increases expression ISO Mogs (Mus musculus) 6480464 Chlorpyrifos results in increased expression of MOGS mRNA CTD PMID:37019170 Mogs Rat chromium(6+) affects expression ISO Mogs (Mus musculus) 6480464 chromium hexavalent ion affects the expression of MOGS mRNA CTD PMID:28472532 Mogs Rat ciguatoxin CTX1B affects expression ISO Mogs (Mus musculus) 6480464 Ciguatoxins affects the expression of MOGS mRNA CTD PMID:18353800 Mogs Rat copper(II) sulfate decreases expression ISO MOGS (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of MOGS mRNA CTD PMID:19549813 Mogs Rat cyclosporin A increases expression ISO MOGS (Homo sapiens) 6480464 Cyclosporine results in increased expression of MOGS mRNA CTD PMID:20106945 and PMID:27989131 Mogs Rat cyclosporin A decreases expression ISO MOGS (Homo sapiens) 6480464 Cyclosporine results in decreased expression of MOGS mRNA CTD PMID:25562108 Mogs Rat DDT decreases expression EXP 6480464 DDT results in decreased expression of MOGS mRNA CTD PMID:30207508 Mogs Rat dexamethasone multiple interactions ISO MOGS (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of MOGS mRNA CTD PMID:28628672 Mogs Rat diallyl disulfide multiple interactions EXP 6480464 [Cadmium Chloride co-treated with diallyl disulfide] results in increased expression of MOGS mRNA CTD PMID:31077537 Mogs Rat Dibutyl phosphate affects expression ISO MOGS (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of MOGS mRNA CTD PMID:37042841 Mogs Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of MOGS mRNA CTD PMID:21266533 Mogs Rat doxorubicin decreases expression ISO MOGS (Homo sapiens) 6480464 Doxorubicin results in decreased expression of MOGS mRNA CTD PMID:29803840 Mogs Rat ethanol affects expression ISO Mogs (Mus musculus) 6480464 Ethanol affects the expression of MOGS mRNA CTD PMID:30319688 Mogs Rat ethyl methanesulfonate decreases expression ISO MOGS (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of MOGS mRNA CTD PMID:23649840 Mogs Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of MOGS mRNA CTD PMID:24136188 Mogs Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of MOGS mRNA CTD PMID:24793618 Mogs Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of MOGS mRNA CTD PMID:24136188 Mogs Rat folic acid multiple interactions ISO Mogs (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of MOGS mRNA] CTD PMID:22206623 Mogs Rat formaldehyde decreases expression ISO MOGS (Homo sapiens) 6480464 Formaldehyde results in decreased expression of MOGS mRNA CTD PMID:23649840 Mogs Rat genistein multiple interactions ISO MOGS (Homo sapiens) 6480464 ESR1 promotes the reaction [Genistein results in decreased expression of MOGS protein] CTD PMID:20884965 Mogs Rat genistein decreases expression ISO MOGS (Homo sapiens) 6480464 Genistein results in decreased expression of MOGS protein CTD PMID:20884965 Mogs Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of MOGS mRNA CTD PMID:22061828 Mogs Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of MOGS mRNA CTD PMID:33387578 Mogs Rat indometacin multiple interactions ISO MOGS (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of MOGS mRNA CTD PMID:28628672 Mogs Rat ivermectin decreases expression ISO MOGS (Homo sapiens) 6480464 Ivermectin results in decreased expression of MOGS protein CTD PMID:32959892 Mogs Rat lead(0) decreases expression ISO MOGS (Homo sapiens) 6480464 Lead results in decreased expression of MOGS mRNA CTD PMID:19921347 Mogs Rat lipopolysaccharide multiple interactions ISO Mogs (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Lipopolysaccharides] results in decreased methylation of MOGS gene CTD PMID:21212295 Mogs Rat menadione affects expression ISO MOGS (Homo sapiens) 6480464 Vitamin K 3 affects the expression of MOGS mRNA CTD PMID:20044591 Mogs Rat naphthalenes decreases expression EXP 6480464 Naphthalenes results in decreased expression of MOGS protein CTD PMID:17337753 Mogs Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of MOGS mRNA CTD PMID:24136188 Mogs Rat nitrates multiple interactions ISO Mogs (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of MOGS mRNA CTD PMID:35964746 Mogs Rat ozone multiple interactions ISO MOGS (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of and results in increased oxidation of MOGS mRNA more ... CTD PMID:32699268 Mogs Rat paracetamol affects expression ISO Mogs (Mus musculus) 6480464 Acetaminophen affects the expression of MOGS mRNA CTD PMID:17562736 Mogs Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of MOGS mRNA CTD PMID:33387578 Mogs Rat perfluorooctane-1-sulfonic acid decreases expression ISO Mogs (Mus musculus) 6480464 perfluorooctane sulfonic acid results in decreased expression of MOGS protein CTD PMID:26178269 Mogs Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Mogs (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of MOGS mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of MOGS mRNA CTD PMID:36331819 Mogs Rat pirinixic acid decreases expression ISO Mogs (Mus musculus) 6480464 pirinixic acid results in decreased expression of MOGS mRNA CTD PMID:18445702 Mogs Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of MOGS protein CTD PMID:35544339 Mogs Rat SB 431542 multiple interactions ISO MOGS (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of MOGS protein CTD PMID:37664457 Mogs Rat sodium arsenite decreases expression ISO MOGS (Homo sapiens) 6480464 sodium arsenite results in decreased expression of MOGS mRNA CTD PMID:38568856 Mogs Rat sodium arsenite multiple interactions ISO MOGS (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of MOGS mRNA CTD PMID:39836092 Mogs Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of MOGS mRNA CTD PMID:19281266 Mogs Rat sulindac decreases expression EXP 6480464 Sulindac results in decreased expression of MOGS mRNA CTD PMID:24136188 Mogs Rat tetrachloromethane increases expression ISO Mogs (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of MOGS mRNA CTD PMID:31919559 Mogs Rat thapsigargin increases expression ISO MOGS (Homo sapiens) 6480464 Thapsigargin results in increased expression of MOGS mRNA CTD PMID:22378314 Mogs Rat thiram decreases expression ISO MOGS (Homo sapiens) 6480464 Thiram results in decreased expression of MOGS mRNA CTD PMID:38568856 Mogs Rat titanium dioxide decreases methylation ISO Mogs (Mus musculus) 6480464 titanium dioxide results in decreased methylation of MOGS gene CTD PMID:35295148 Mogs Rat trimellitic anhydride increases expression ISO Mogs (Mus musculus) 6480464 trimellitic anhydride results in increased expression of MOGS mRNA CTD PMID:19042947 Mogs Rat triphenyl phosphate affects expression ISO MOGS (Homo sapiens) 6480464 triphenyl phosphate affects the expression of MOGS mRNA CTD PMID:37042841 Mogs Rat trovafloxacin multiple interactions ISO Mogs (Mus musculus) 6480464 [trovafloxacin co-treated with lipopolysaccharide and E coli O55-B5] results in decreased expression of MOGS mRNA CTD PMID:18930950 Mogs Rat tunicamycin increases expression ISO MOGS (Homo sapiens) 6480464 Tunicamycin results in increased expression of MOGS mRNA CTD PMID:22378314 Mogs Rat valproic acid affects expression ISO Mogs (Mus musculus) 6480464 Valproic Acid affects the expression of MOGS mRNA CTD PMID:17292431
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) acrolein (ISO) acrylamide (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) cadmium dichloride (EXP,ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) chromium(6+) (ISO) ciguatoxin CTX1B (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) DDT (EXP) dexamethasone (ISO) diallyl disulfide (EXP) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) doxorubicin (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) finasteride (EXP) flutamide (EXP) folic acid (ISO) formaldehyde (ISO) genistein (ISO) gentamycin (EXP) indometacin (ISO) ivermectin (ISO) lead(0) (ISO) lipopolysaccharide (ISO) menadione (ISO) naphthalenes (EXP) nimesulide (EXP) nitrates (ISO) ozone (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) pirinixic acid (ISO) rotenone (EXP) SB 431542 (ISO) sodium arsenite (ISO) Soman (EXP) sulindac (EXP) tetrachloromethane (ISO) thapsigargin (ISO) thiram (ISO) titanium dioxide (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) trovafloxacin (ISO) tunicamycin (ISO) valproic acid (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
3.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
4.
Online Mendelian Inheritance in Man, OMIM (TM).
Online Mendelian Inheritance in Man, OMIM (TM).
5.
GOA pipeline
RGD automated data pipeline
6.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
9.
Chromosomal mapping of genes controlling development, histological grade, depth of invasion, and size of rat stomach carcinomas.
Ushijima T, etal., Cancer Res 2000 Feb 15;60(4):1092-6.
Mogs Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 117,179,335 - 117,182,738 (+) NCBI GRCr8 mRatBN7.2 4 115,621,623 - 115,625,026 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 115,621,623 - 115,625,032 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 121,098,230 - 121,101,633 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 116,873,422 - 116,876,825 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 115,487,997 - 115,491,399 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 113,948,328 - 113,951,731 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 113,948,514 - 113,951,847 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 178,633,399 - 178,636,802 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 117,327,609 - 117,331,012 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 117,572,089 - 117,575,493 (+) NCBI Celera 4 104,615,822 - 104,619,225 (+) NCBI Celera Cytogenetic Map 4 q34 NCBI
MOGS Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 74,461,057 - 74,465,382 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 74,461,057 - 74,465,410 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 74,688,184 - 74,692,509 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 74,541,692 - 74,546,045 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 74,599,850 - 74,604,161 NCBI Celera 2 74,519,373 - 74,523,726 (-) NCBI Celera Cytogenetic Map 2 p13.1 NCBI HuRef 2 74,424,479 - 74,428,832 (-) NCBI HuRef CHM1_1 2 74,617,601 - 74,621,954 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 74,469,624 - 74,473,950 (-) NCBI T2T-CHM13v2.0
Mogs Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 83,092,477 - 83,095,883 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 83,092,477 - 83,095,879 (+) Ensembl GRCm39 Ensembl GRCm38 6 83,115,506 - 83,118,902 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 83,115,496 - 83,118,898 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 83,065,500 - 83,068,892 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 83,081,164 - 83,084,556 (+) NCBI MGSCv36 mm8 Celera 6 85,098,207 - 85,101,599 (+) NCBI Celera Cytogenetic Map 6 C3 NCBI cM Map 6 35.94 NCBI
Mogs Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955424 11,290,849 - 11,324,464 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955424 11,317,605 - 11,321,192 (+) NCBI ChiLan1.0 ChiLan1.0
MOGS Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 51,923,246 - 51,928,159 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 51,925,983 - 51,930,912 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 74,527,710 - 74,532,319 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 76,033,692 - 76,038,561 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 76,033,692 - 76,038,561 (-) Ensembl panpan1.1 panPan2
MOGS Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 48,666,220 - 48,670,848 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 48,667,224 - 48,670,646 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 48,309,013 - 48,312,735 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 49,526,369 - 49,530,091 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 49,522,868 - 49,530,078 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 48,543,489 - 48,547,212 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 48,610,253 - 48,613,972 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 49,167,959 - 49,171,681 (+) NCBI UU_Cfam_GSD_1.0
Mogs
MOGS Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 68,578,218 - 68,581,990 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 68,578,207 - 68,581,995 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 71,840,317 - 71,844,100 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MOGS Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 14 32,812,318 - 32,816,358 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 14 32,812,065 - 32,820,175 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 79,354,282 - 79,358,588 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mogs
.
Predicted Target Of
Count of predictions: 130 Count of miRNA genes: 113 Interacting mature miRNAs: 117 Transcripts: ENSRNOT00000011521 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1582232 Gluco25 Glucose level QTL 25 3.6 0.0023 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 85253748 148090731 Rat 631689 Scl4 Serum cholesterol level QTL 4 1.9 0.008 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 95174120 140174120 Rat 1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 1578655 Bmd11 Bone mineral density QTL 11 11 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 4 90850165 135850165 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 1357342 Bw40 Body weight QTL 40 0.001 body mass (VT:0001259) body weight (CMO:0000012) 4 76647384 117676292 Rat 631556 Bp135 Blood pressure QTL 135 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 78881294 117676292 Rat 61330 Eau1 Experimental allergic uveoretinitis QTL 1 0.0003 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 4 70362013 132642728 Rat 70167 Bw22 Body weight QTL 22 3.1 body mass (VT:0001259) body weight (CMO:0000012) 4 76647384 117676292 Rat 731165 Uae21 Urinary albumin excretion QTL 21 2.4 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 4 106649412 151649412 Rat 737821 Hcar9 Hepatocarcinoma resistance QTL 9 3.7 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 109866907 167139601 Rat 1549832 Bss3 Bone structure and strength QTL 3 11 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 4 109827074 154827074 Rat 70177 Xhs1 X-ray hypersensitivity QTL 1 25.1 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 82798864 152731274 Rat 724522 Bp146 Blood pressure QTL 146 2.2 0.0021 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 73630210 118630210 Rat 61476 Aia3 Adjuvant induced arthritis QTL 3 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 86730991 131730991 Rat 1641919 Alc22 Alcohol consumption QTL 22 0.0005 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 81192555 126192555 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 1298082 Stresp4 Stress response QTL 4 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 50119848 146803430 Rat 1578670 Bss14 Bone structure and strength QTL 14 16.4 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 4 87327165 132327165 Rat 1300139 Hrtrt6 Heart rate QTL 6 2.85 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 39524264 116179656 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 1331759 Hrtrt13 Heart rate QTL 13 3.54628 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 110275411 168266883 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 1578662 Bss15 Bone structure and strength QTL 15 19.6 femur width (VT:1000666) femoral neck width (CMO:0001695) 4 87327165 132327165 Rat 2302051 Pia28 Pristane induced arthritis QTL 28 5.3 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 73630210 118630210 Rat 2302049 Pia32 Pristane induced arthritis QTL 32 5.1 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 105789505 150789505 Rat 6478763 Anxrr46 Anxiety related response QTL 46 0.07428 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 6478760 Anxrr45 Anxiety related response QTL 45 0.06717 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 738015 Pia9 Pristane induced arthritis QTL 9 4.5 0.048 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 80694870 125694870 Rat 7207480 Bss105 Bone structure and strength QTL 105 8.1 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 4 109827074 154827074 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 631646 Stl4 Serum triglyceride level QTL 4 6.5 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 4 73169846 132642728 Rat 634334 Xhs3 X-ray hypersensitivity QTL 3 10 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 84728680 129854654 Rat 61406 Scwia1 Streptococcal cell wall induced arthritis QTL 1 2.3 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 4 106805662 151805662 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 634344 Hcar7 Hepatocarcinoma resistance QTL 7 7.8 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 4 70808386 115808386 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 631662 Hcar2 Hepatocarcinoma resistance QTL 2 3.1 0.0003 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 78878504 123878504 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 61418 Pia5 Pristane induced arthritis QTL 5 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 62277855 128289560 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 1641833 Alc21 Alcohol consumption QTL 21 8.6 0.0001 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 56698790 126192555 Rat 2306899 Bp338 Blood pressure QTL 338 0.071 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 81006124 120102625 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 12798519 Anxrr54 Anxiety related response QTL 54 2.54 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 114627026 159627026 Rat 12798523 Anxrr56 Anxiety related response QTL 56 2.83 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 85253748 150276390 Rat 61434 Cia3 Collagen induced arthritis QTL 3 4.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 103194656 148194656 Rat
D15Mgh4
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 15 82,713,931 - 82,714,037 (+) Marker Load Pipeline mRatBN7.2 15 76,306,099 - 76,306,205 (+) MAPPER mRatBN7.2 Rnor_6.0 15 83,947,714 - 83,947,819 NCBI Rnor6.0 Rnor_5.0 15 87,456,591 - 87,456,696 UniSTS Rnor5.0 RGSC_v3.4 15 83,349,371 - 83,349,477 RGD RGSC3.4 RGSC_v3.4 15 83,349,372 - 83,349,477 UniSTS RGSC3.4 RGSC_v3.1 15 83,365,152 - 83,365,257 RGD Celera 15 75,545,830 - 75,545,935 UniSTS RH 3.4 Map 15 528.0 UniSTS RH 3.4 Map 15 528.0 RGD RH 2.0 Map 15 405.8 RGD SHRSP x BN Map 15 48.3298 RGD Cytogenetic Map 4 q34 UniSTS
D15Rat29
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 15 106,778,197 - 106,778,366 (+) Marker Load Pipeline RGSC_v3.4 15 108,387,242 - 108,387,411 RGD RGSC3.4 RGSC_v3.4 15 108,387,243 - 108,387,411 UniSTS RGSC3.4 RGSC_v3.1 15 108,403,023 - 108,403,191 RGD Celera 15 99,127,682 - 99,127,850 UniSTS RH 3.4 Map 15 766.2 UniSTS RH 3.4 Map 15 766.2 RGD RH 2.0 Map 15 653.9 RGD SHRSP x BN Map 15 66.5198 RGD FHH x ACI Map 15 74.04 RGD Cytogenetic Map 4 q34 UniSTS
D15Rat102
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 90,088,591 - 90,088,744 (+) MAPPER mRatBN7.2 Rnor_6.0 15 98,027,558 - 98,027,710 NCBI Rnor6.0 Rnor_5.0 15 101,499,599 - 101,499,751 UniSTS Rnor5.0 RGSC_v3.4 15 97,700,574 - 97,700,727 RGD RGSC3.4 RGSC_v3.4 15 97,700,575 - 97,700,727 UniSTS RGSC3.4 RGSC_v3.1 15 97,716,355 - 97,716,507 RGD Celera 15 89,023,691 - 89,023,843 UniSTS RH 3.4 Map 15 619.29 RGD RH 3.4 Map 15 619.29 UniSTS RH 2.0 Map 15 556.3 RGD SHRSP x BN Map 15 58.5998 RGD Cytogenetic Map 4 q34 UniSTS
RH140742
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 4 117,179,625 - 117,179,960 (+) Marker Load Pipeline mRatBN7.2 4 115,621,913 - 115,622,248 (+) MAPPER mRatBN7.2 Rnor_6.0 4 113,948,619 - 113,948,953 NCBI Rnor6.0 Rnor_6.0 4 114,814,347 - 114,814,681 NCBI Rnor6.0 Rnor_5.0 4 178,633,690 - 178,634,024 UniSTS Rnor5.0 RGSC_v3.4 4 117,327,900 - 117,328,234 UniSTS RGSC3.4 Celera 4 104,616,113 - 104,616,447 UniSTS Cytogenetic Map 4 q34 UniSTS
UniSTS:546869
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 115,623,776 - 115,624,811 (+) MAPPER mRatBN7.2 Rnor_6.0 4 113,950,482 - 113,951,516 NCBI Rnor6.0 Rnor_6.0 4 114,816,210 - 114,817,244 NCBI Rnor6.0 Rnor_5.0 4 178,635,553 - 178,636,587 UniSTS Rnor5.0 Celera 4 104,617,976 - 104,619,010 UniSTS Cytogenetic Map 4 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
7
7
43
50
50
21
21
21
6
90
45
26
17
25
29
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000011521 ⟹ ENSRNOP00000011521
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 4 113,948,514 - 113,951,847 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000083560 ⟹ ENSRNOP00000074720
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 115,621,623 - 115,625,032 (+) Ensembl Rnor_6.0 Ensembl 4 114,814,056 - 114,817,465 (+) Ensembl
RefSeq Acc Id:
NM_031749 ⟹ NP_113937
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 117,179,335 - 117,182,738 (+) NCBI mRatBN7.2 4 115,621,623 - 115,625,026 (+) NCBI Rnor_6.0 4 113,948,328 - 113,951,731 (+) NCBI Rnor_5.0 4 178,633,399 - 178,636,802 (+) NCBI RGSC_v3.4 4 117,327,609 - 117,331,012 (+) RGD Celera 4 104,615,822 - 104,619,225 (+) RGD
Sequence:
GCCCGCATGGCCCGGGGCGAGAGGCGACGGCGCGCTGCGGCCGCAGAGGGGGCGCGCCCGCTGGAGAGGGCGCGGGGTGCGGGCCGGCGGGATGGCAGAGCCGGCGGGGCGCGCGGCTCGGCGGGCGG
hide sequence
RefSeq Acc Id:
NP_113937 ⟸ NM_031749
- UniProtKB:
O88941 (UniProtKB/Swiss-Prot), A0A0G2K8S6 (UniProtKB/TrEMBL), A6IAK3 (UniProtKB/TrEMBL)
- Sequence:
MARGERRRRAAAAEGARPLERARGAGRRDGRAGGARGSAGGAALAVVVLALAFGLSGRWVLAWLGVRRALTLHPAPSALPPDSSSPAVAPEFFWGTYRPHVYFGMKTRSPKPLLTGLMWAQQGATPGT
hide sequence
Ensembl Acc Id:
ENSRNOP00000011521 ⟸ ENSRNOT00000011521
Ensembl Acc Id:
ENSRNOP00000074720 ⟸ ENSRNOT00000083560
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Mogs
mannosyl-oligosaccharide glucosidase
LOC103692171
mannosyl-oligosaccharide glucosidase
Data merged from RGD:9236907
737654 PROVISIONAL
2014-08-25
LOC103692171
mannosyl-oligosaccharide glucosidase
Symbol and Name status set to provisional
70820 PROVISIONAL
2012-01-25
Mogs
mannosyl-oligosaccharide glucosidase
Gcs1
glucosidase 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2003-04-09
Gcs1
glucosidase 1
Symbol and Name updated
629477 APPROVED
2003-03-10
Gcs1
glucosidase 1
Gcs1-pending
glucosidase 1
Data merged from RGD:619927
628472 PROVISIONAL
2002-08-07
Gcs1-pending
glucosidase 1
Symbol and Name status set to provisional
70820 PROVISIONAL
2002-06-10
Gcs1
glucosidase 1
Name updated
70584 APPROVED
