Mogs (mannosyl-oligosaccharide glucosidase)

Advanced Search (OLGA)

Gene: Mogs (mannosyl-oligosaccharide glucosidase) Rattus norvegicus

Analyze

Symbol:

Mogs

Name:

mannosyl-oligosaccharide glucosidase

RGD ID:

69240

Description:

Predicted to enable Glc3Man9GlcNAc2 oligosaccharide glucosidase activity. Predicted to be involved in protein N-linked glycosylation. Predicted to be located in endoplasmic reticulum. Predicted to be active in endoplasmic reticulum membrane. Human ortholog(s) of this gene implicated in congenital disorder of glycosylation type IIb. Orthologous to human MOGS (mannosyl-oligosaccharide glucosidase); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; ammonium chloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Gcs1; glucosidase 1; glycoprotein-processing glucosidase I; LOC103692171

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MOGS (mannosyl-oligosaccharide glucosidase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Mogs (mannosyl-oligosaccharide glucosidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mogs (mannosyl-oligosaccharide glucosidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MOGS (mannosyl-oligosaccharide glucosidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MOGS (mannosyl-oligosaccharide glucosidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mogs (mannosyl-oligosaccharide glucosidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MOGS (mannosyl-oligosaccharide glucosidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MOGS (mannosyl-oligosaccharide glucosidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mogs (mannosyl-oligosaccharide glucosidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	MOGS (mannosyl-oligosaccharide glucosidase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Mogs (mannosyl-oligosaccharide glucosidase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mogs (mannosyl-oligosaccharide glucosidase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CWH41	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	GCS1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mogs-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mogs	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	117,179,335 - 117,182,738 (+)	NCBI		GRCr8
mRatBN7.2	4	115,621,623 - 115,625,026 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	115,621,623 - 115,625,032 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	121,098,230 - 121,101,633 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	116,873,422 - 116,876,825 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	115,487,997 - 115,491,399 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	113,948,328 - 113,951,731 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	113,948,514 - 113,951,847 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	178,633,399 - 178,636,802 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	117,327,609 - 117,331,012 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	117,572,089 - 117,575,493 (+)	NCBI
Celera	4	104,615,822 - 104,619,225 (+)	NCBI		Celera
Cytogenetic Map	4	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

congenital disorder of glycosylation type IIb (ISO)

dystonia (ISO)

genetic disease (ISO)

Methylmalonyl-CoA Epimerase Deficiency (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

acrolein (ISO)

acrylamide (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

cadmium dichloride (EXP,ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

ciguatoxin CTX1B (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

DDT (EXP)

dexamethasone (ISO)

diallyl disulfide (EXP)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

doxorubicin (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

genistein (ISO)

gentamycin (EXP)

indometacin (ISO)

ivermectin (ISO)

lead(0) (ISO)

lipopolysaccharide (ISO)

menadione (ISO)

naphthalenes (EXP)

nimesulide (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

rotenone (EXP)

SB 431542 (ISO)

sodium arsenite (ISO)

Soman (EXP)

sulindac (EXP)

tetrachloromethane (ISO)

thapsigargin (ISO)

thiram (ISO)

titanium dioxide (ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

trovafloxacin (ISO)

tunicamycin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

oligosaccharide metabolic process (IEA)

protein N-linked glycosylation (IBA,IEA)

Cellular Component

endoplasmic reticulum (ISO)

endoplasmic reticulum membrane (IBA,IEA)

Molecular Function

Glc3Man9GlcNAc2 oligosaccharide glucosidase activity (IBA,IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
3.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
4.	Online Mendelian Inheritance in Man, OMIM (TM).	Online Mendelian Inheritance in Man, OMIM (TM).
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
9.	Chromosomal mapping of genes controlling development, histological grade, depth of invasion, and size of rat stomach carcinomas.	Ushijima T, etal., Cancer Res 2000 Feb 15;60(4):1092-6.

Additional References at PubMed

PMID:1885588	PMID:19056867	PMID:19199708	PMID:19946888

Genomics

Comparative Map Data

Mogs
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	117,179,335 - 117,182,738 (+)	NCBI		GRCr8
mRatBN7.2	4	115,621,623 - 115,625,026 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	115,621,623 - 115,625,032 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	121,098,230 - 121,101,633 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	116,873,422 - 116,876,825 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	115,487,997 - 115,491,399 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	113,948,328 - 113,951,731 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	113,948,514 - 113,951,847 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	178,633,399 - 178,636,802 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	117,327,609 - 117,331,012 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	117,572,089 - 117,575,493 (+)	NCBI
Celera	4	104,615,822 - 104,619,225 (+)	NCBI		Celera
Cytogenetic Map	4	q34	NCBI

MOGS
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	74,461,057 - 74,465,382 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	74,461,057 - 74,465,410 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	74,688,184 - 74,692,509 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	74,541,692 - 74,546,045 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	74,599,850 - 74,604,161	NCBI
Celera	2	74,519,373 - 74,523,726 (-)	NCBI		Celera
Cytogenetic Map	2	p13.1	NCBI
HuRef	2	74,424,479 - 74,428,832 (-)	NCBI		HuRef
CHM1_1	2	74,617,601 - 74,621,954 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	74,469,624 - 74,473,950 (-)	NCBI		T2T-CHM13v2.0

Mogs
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	83,092,477 - 83,095,883 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	83,092,477 - 83,095,879 (+)	Ensembl		GRCm39 Ensembl
GRCm38	6	83,115,506 - 83,118,902 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	83,115,496 - 83,118,898 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	83,065,500 - 83,068,892 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	83,081,164 - 83,084,556 (+)	NCBI		MGSCv36	mm8
Celera	6	85,098,207 - 85,101,599 (+)	NCBI		Celera
Cytogenetic Map	6	C3	NCBI
cM Map	6	35.94	NCBI

Mogs
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955424	11,290,849 - 11,324,464 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955424	11,317,605 - 11,321,192 (+)	NCBI	ChiLan1.0	ChiLan1.0

MOGS
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	51,923,246 - 51,928,159 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	51,925,983 - 51,930,912 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	74,527,710 - 74,532,319 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	76,033,692 - 76,038,561 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	76,033,692 - 76,038,561 (-)	Ensembl	panpan1.1		panPan2

MOGS
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	48,666,220 - 48,670,848 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	48,667,224 - 48,670,646 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	48,309,013 - 48,312,735 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	49,526,369 - 49,530,091 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	49,522,868 - 49,530,078 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	48,543,489 - 48,547,212 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	48,610,253 - 48,613,972 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	49,167,959 - 49,171,681 (+)	NCBI		UU_Cfam_GSD_1.0

Mogs
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	10,049,848 - 10,053,698 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936556	684,394 - 688,056 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936556	684,203 - 688,037 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MOGS
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	68,578,218 - 68,581,990 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	68,578,207 - 68,581,995 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	71,840,317 - 71,844,100 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MOGS
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	32,812,318 - 32,816,358 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	32,812,065 - 32,820,175 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	79,354,282 - 79,358,588 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mogs
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624749	29,040,983 - 29,048,918 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624749	29,041,631 - 29,045,407 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Mogs
10 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	130
Count of miRNA genes:	113
Interacting mature miRNAs:	117
Transcripts:	ENSRNOT00000011521
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631689	Scl4	Serum cholesterol level QTL 4	1.9	0.008	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	95174120	140174120	Rat
1582232	Gluco25	Glucose level QTL 25	3.6	0.0023	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	85253748	148090731	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
1578655	Bmd11	Bone mineral density QTL 11	11		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	4	90850165	135850165	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	26775591	168368347	Rat
1357342	Bw40	Body weight QTL 40		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	4	76647384	117676292	Rat
631556	Bp135	Blood pressure QTL 135		0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	78881294	117676292	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	70362013	132642728	Rat
70167	Bw22	Body weight QTL 22	3.1		body mass (VT:0001259)	body weight (CMO:0000012)	4	76647384	117676292	Rat
731165	Uae21	Urinary albumin excretion QTL 21	2.4	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	106649412	151649412	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	109866907	167139601	Rat
1549832	Bss3	Bone structure and strength QTL 3	11		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	4	109827074	154827074	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82798864	152731274	Rat
724522	Bp146	Blood pressure QTL 146	2.2	0.0021	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	73630210	118630210	Rat
61476	Aia3	Adjuvant induced arthritis QTL 3	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	86730991	131730991	Rat
1641919	Alc22	Alcohol consumption QTL 22		0.0005	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	81192555	126192555	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	50119848	146803430	Rat
1578670	Bss14	Bone structure and strength QTL 14	16.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	4	87327165	132327165	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	39524264	116179656	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
1331759	Hrtrt13	Heart rate QTL 13	3.54628		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	110275411	168266883	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
1578662	Bss15	Bone structure and strength QTL 15	19.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	4	87327165	132327165	Rat
2302051	Pia28	Pristane induced arthritis QTL 28	5.3	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	73630210	118630210	Rat
2302049	Pia32	Pristane induced arthritis QTL 32	5.1	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	105789505	150789505	Rat
6478763	Anxrr46	Anxiety related response QTL 46		0.07428	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
6478760	Anxrr45	Anxiety related response QTL 45		0.06717	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
738015	Pia9	Pristane induced arthritis QTL 9	4.5	0.048	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	80694870	125694870	Rat
2312567	Glom19	Glomerulus QTL 19	1.9	0.006	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	4	45456990	146803430	Rat
7207480	Bss105	Bone structure and strength QTL 105	8.1		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	4	109827074	154827074	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	93308457	167139447	Rat
631646	Stl4	Serum triglyceride level QTL 4	6.5	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	4	73169846	132642728	Rat
634334	Xhs3	X-ray hypersensitivity QTL 3	10		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	84728680	129854654	Rat
61406	Scwia1	Streptococcal cell wall induced arthritis QTL 1	2.3		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	4	106805662	151805662	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
634344	Hcar7	Hepatocarcinoma resistance QTL 7	7.8		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	4	70808386	115808386	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	83428419	177635233	Rat
631662	Hcar2	Hepatocarcinoma resistance QTL 2	3.1	0.0003	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	78878504	123878504	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
61418	Pia5	Pristane induced arthritis QTL 5	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	62277855	128289560	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	85379421	167139601	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	56698790	126192555	Rat
2306899	Bp338	Blood pressure QTL 338		0.071	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	81006124	120102625	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	64528739	157573521	Rat
12798519	Anxrr54	Anxiety related response QTL 54	2.54	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	114627026	159627026	Rat
12798523	Anxrr56	Anxiety related response QTL 56	2.83	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	85253748	150276390	Rat
61434	Cia3	Collagen induced arthritis QTL 3	4.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	103194656	148194656	Rat

Markers in Region

D15Mgh4

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	76,306,099 - 76,306,205 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	83,947,714 - 83,947,819	NCBI	Rnor6.0
Rnor_5.0	15	87,456,591 - 87,456,696	UniSTS	Rnor5.0
RGSC_v3.4	15	83,349,371 - 83,349,477	RGD	RGSC3.4
RGSC_v3.4	15	83,349,372 - 83,349,477	UniSTS	RGSC3.4
RGSC_v3.1	15	83,365,152 - 83,365,257	RGD
Celera	15	75,545,830 - 75,545,935	UniSTS
RH 3.4 Map	15	528.0	UniSTS
RH 3.4 Map	15	528.0	RGD
RH 2.0 Map	15	405.8	RGD
SHRSP x BN Map	15	48.3298	RGD
Cytogenetic Map	4	q34	UniSTS

D15Rat29

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RGSC_v3.4	15	108,387,243 - 108,387,411	UniSTS	RGSC3.4
RGSC_v3.4	15	108,387,242 - 108,387,411	RGD	RGSC3.4
RGSC_v3.1	15	108,403,023 - 108,403,191	RGD
Celera	15	99,127,682 - 99,127,850	UniSTS
RH 3.4 Map	15	766.2	RGD
RH 3.4 Map	15	766.2	UniSTS
RH 2.0 Map	15	653.9	RGD
SHRSP x BN Map	15	66.5198	RGD
FHH x ACI Map	15	74.04	RGD
Cytogenetic Map	4	q34	UniSTS

D15Rat102

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	90,088,591 - 90,088,744 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	98,027,558 - 98,027,710	NCBI	Rnor6.0
Rnor_5.0	15	101,499,599 - 101,499,751	UniSTS	Rnor5.0
RGSC_v3.4	15	97,700,574 - 97,700,727	RGD	RGSC3.4
RGSC_v3.4	15	97,700,575 - 97,700,727	UniSTS	RGSC3.4
RGSC_v3.1	15	97,716,355 - 97,716,507	RGD
Celera	15	89,023,691 - 89,023,843	UniSTS
RH 3.4 Map	15	619.29	RGD
RH 3.4 Map	15	619.29	UniSTS
RH 2.0 Map	15	556.3	RGD
SHRSP x BN Map	15	58.5998	RGD
Cytogenetic Map	4	q34	UniSTS

RH140742

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	115,621,913 - 115,622,248 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	113,948,619 - 113,948,953	NCBI	Rnor6.0
Rnor_6.0	4	114,814,347 - 114,814,681	NCBI	Rnor6.0
Rnor_5.0	4	178,633,690 - 178,634,024	UniSTS	Rnor5.0
RGSC_v3.4	4	117,327,900 - 117,328,234	UniSTS	RGSC3.4
Celera	4	104,616,113 - 104,616,447	UniSTS
Cytogenetic Map	4	q34	UniSTS

UniSTS:546869

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	115,623,776 - 115,624,811 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	113,950,482 - 113,951,516	NCBI	Rnor6.0
Rnor_6.0	4	114,816,210 - 114,817,244	NCBI	Rnor6.0
Rnor_5.0	4	178,635,553 - 178,636,587	UniSTS	Rnor5.0
Celera	4	104,617,976 - 104,619,010	UniSTS
Cytogenetic Map	4	q34	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
7	7	43	50	50	21	21	21	6	90	45	26	17	25	29

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031749	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC130866	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF087431	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473957	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000011521 ⟹ ENSRNOP00000011521

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	4	113,948,514 - 113,951,847 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000083560 ⟹ ENSRNOP00000074720

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	115,621,623 - 115,625,032 (+)	Ensembl
Rnor_6.0 Ensembl	4	114,814,056 - 114,817,465 (+)	Ensembl

RefSeq Acc Id:

NM_031749 ⟹ NP_113937

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	117,179,335 - 117,182,738 (+)	NCBI
mRatBN7.2	4	115,621,623 - 115,625,026 (+)	NCBI
Rnor_6.0	4	113,948,328 - 113,951,731 (+)	NCBI
Rnor_5.0	4	178,633,399 - 178,636,802 (+)	NCBI
RGSC_v3.4	4	117,327,609 - 117,331,012 (+)	RGD
Celera	4	104,615,822 - 104,619,225 (+)	RGD

Sequence:

show sequence

GCCCGCATGGCCCGGGGCGAGAGGCGACGGCGCGCTGCGGCCGCAGAGGGGGCGCGCCCGCTGG
AGAGGGCGCGGGGTGCGGGCCGGCGGGATGGCAGAGCCGGCGGGGCGCGCGGCTCGGCGGGCGG
CGCGGCCCTGGCCGTGGTGGTTTTGGCGCTGGCCTTCGGCCTGTCGGGGCGCTGGGTGCTGGCG
TGGCTGGGTGTGCGCCGCGCGCTCACACTGCACCCCGCTCCGTCAGCGCTACCGCCGGACTCCT
CCAGTCCTGCCGTGGCCCCGGAATTTTTTTGGGGTACCTATCGCCCACACGTCTATTTCGGCAT
GAAGACTCGCAGCCCCAAACCACTGCTCACGGGACTGATGTGGGCGCAGCAAGGCGCCACCCCG
GGGACCCCTCCTAAGCTCAGGCACACATGCGAACAAGGAGACGGCGTGGGTCCCTATGGCTGGG
AGTTCCATGATGGACTCTCCTTTGGTCGGCAACATATCTATGATGGGGCCTTAAGGCTCACCAC
TGAGTTCGTCAAGAGATCTGGGGGTCATCACGGAGGGGATTGGAGCTGGAGAGTTACCGTAGAG
CCTCAGGCCTCAGGTACACCTTCCTTCCCTTTGGTCTCCCTGTTCTTCTACGTGGTAACAGATG
GGCAAGAGGTCCTACTACCAGAGGTTGGAGCCAAAGGACAGTTGAAGTTCATCAGTGGGCACAC
CAGTGAACTTGGTGACTTCCGCCTCACACTTCTGCCACCAACCACTCCAGGAGACACTGTCCCT
AAGCATGGCAGCTACAATGTCTTCTGGTCCTCCAACCCAGGGCTGCCTCTGCTCACAGACATGG
TAAAGAGCCACCTAAACAGCTGGTTTCATCACCGGCCCCCAGGAGCCTCTCCGGAACGATACCT
TGGCTTGCCTGGATCTCTTAAGTGGGAAGAGAGAGGCCCTAGTGGGCAAGGGCAGTTCTTGGTC
CAGCAGGTGACACTGAAAGCCCCTTTCTCTGTGGAGTTTGTGTTTGAATCTGGCAGTGCCAGGA
CAGGAAGAGACCAAGCCTCTGAGCAGCTGGTAGGTGGCCAACTGACCCGGGCCCTGGAGAGCCA
TGCTGCAGCATTCAAGGAGCGTTTTGAGAGGACCTTCCAGCTAAAGGAGAAGGGCCTGAGCCCT
GAGGAGCAGGCTCTGGGTCAGGTTGCCCTCAGTGGCCTACTTGGTGGGATTGGTTACTTCTATG
GACAGGGTTTGGTGTTGCCAGACACTGGCATGGAAGGGTCTGAACAGAAAATGGACCCTTCCCT
ATTTCCGCCTGTCCCCCTTTTCTCTGGGGTCCCTTCCCGGTCATTCTTCCCACGAGGCTTCCTC
TGGGATGAAGGCTTTCACCAGCTAGTGGTCCAGCGATGGGATCCCCACCTCACCCGGGAGGCCC
TAGGACACTGGCTGGGGCTGCTCAATGCTGACGGTTGGATTGGGCGAGAGCAGATTCTGGGGGA
TGAGGCCAGAGCCCGAGTGCCCCCGGAATTCCTAGTGCAACGTGCAGCCCATGCCAACCCTCCA
ACCCTGCTCCTGCCAGTCATACACATGCTAGAAGGCCGGGCCCCTGAGGACTTGGCCTTCCTGC
GCAGGGCTTTCCCCCGCTTGCATGCCTGGTTCTCTTGGCTCCATCAAAGTCAGGCAGGGCCAGT
GCCACTTTCCTACCGCTGGCGGGGCAGGGATCTAGCTTTGCCTACCCTACTTAACCCCAAGACA
CTGCCCTCGGGCCTGGATGACTACCCCAGGGCCTCACATCCTTCTGCAGCAGAGCGGCACCTGG
ACCTGCGGTGCTGGGTGACATTGGGTGCCCGGGTGCTGTCACAGCTTGCAGAAGAGCTTGGGGA
GACTGAAGCTGCTGCAGAGTTGGGCCCATTGGCTGCCTCTCTAGAAGCAGCTGGAAGTCTCGAT
GAGCTGCACTGGGCTCCTGAGCTGGGTGTCTTTGCCGACTTTGGGAACCACACAAAAGCAGTAC
AGCTCAAGTCTAGGCCCCCACAGGGGCTGGTTAGGGTGGTAGGCAGGCCTCCAGCTCGACTGCA
GTATGTGGATGCCCTGGGCTATGTCTCTCTTTTTCCTTTGCTGCTACAACTGCTGGAGCCCAGC
TCACCCCGCTTGGGACCCCTGCTGGACGTTCTAGCTGATAGCCGCCATCTCTGGAGCCCCTTTG
GGTTGCGCTCCCTTTCAGCCTCCAGTCTCTTTTATAAACAGCGAAATACGGAACACGATCCACC
TTACTGGCGAGGTGCGGTGTGGCTGAATATCAACTACCTGGCTTTGGGGGCACTACACCACTAT
GGGCGTGTGGAGGGTCCTCACAAGGTTCAGGCTGCCAAACTCTACCGTGAACTTCGGGCCAATG
TAGTAAGCAACGTACGGCAGCAATACCAGGCTACAGGGTTTCTGTGGGAACAGTACAGTGACCA
GGATGGGCGGGGCATGGGCTGCCGCCCCTTCCAAGGATGGACCAGTCTTGTTTTACTGATCATG
GCTGAAGAGTACTAGTGGGACAGAAGGAAAGCTAGGCCTTTGTGTCACTTGGAATATGCAGACA
AGGGCTTGGGTTTCTGGTCTCAGTGTTTCAGATCCCGTAAGCTCATCTCAGGTGTCTCCTTATT
GTCATCCCATACAGCTCTGGGGTGAACGTGAACTCAAAGAGTCTATTTTTCTAAATAAACTGGA
AAACAACGGAATTC

hide sequence

Protein Sequences


Protein RefSeqs	NP_113937	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC36477	(Get FASTA)	NCBI Sequence Viewer
	EDL91121	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000074720.1
GenBank Protein	O88941	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_113937 ⟸ NM_031749

- UniProtKB:

O88941 (UniProtKB/Swiss-Prot), A0A0G2K8S6 (UniProtKB/TrEMBL), A6IAK3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MARGERRRRAAAAEGARPLERARGAGRRDGRAGGARGSAGGAALAVVVLALAFGLSGRWVLAWL
GVRRALTLHPAPSALPPDSSSPAVAPEFFWGTYRPHVYFGMKTRSPKPLLTGLMWAQQGATPGT
PPKLRHTCEQGDGVGPYGWEFHDGLSFGRQHIYDGALRLTTEFVKRSGGHHGGDWSWRVTVEPQ
ASGTPSFPLVSLFFYVVTDGQEVLLPEVGAKGQLKFISGHTSELGDFRLTLLPPTTPGDTVPKH
GSYNVFWSSNPGLPLLTDMVKSHLNSWFHHRPPGASPERYLGLPGSLKWEERGPSGQGQFLVQQ
VTLKAPFSVEFVFESGSARTGRDQASEQLVGGQLTRALESHAAAFKERFERTFQLKEKGLSPEE
QALGQVALSGLLGGIGYFYGQGLVLPDTGMEGSEQKMDPSLFPPVPLFSGVPSRSFFPRGFLWD
EGFHQLVVQRWDPHLTREALGHWLGLLNADGWIGREQILGDEARARVPPEFLVQRAAHANPPTL
LLPVIHMLEGRAPEDLAFLRRAFPRLHAWFSWLHQSQAGPVPLSYRWRGRDLALPTLLNPKTLP
SGLDDYPRASHPSAAERHLDLRCWVTLGARVLSQLAEELGETEAAAELGPLAASLEAAGSLDEL
HWAPELGVFADFGNHTKAVQLKSRPPQGLVRVVGRPPARLQYVDALGYVSLFPLLLQLLEPSSP
RLGPLLDVLADSRHLWSPFGLRSLSASSLFYKQRNTEHDPPYWRGAVWLNINYLALGALHHYGR
VEGPHKVQAAKLYRELRANVVSNVRQQYQATGFLWEQYSDQDGRGMGCRPFQGWTSLVLLIMAE
EY

hide sequence

Ensembl Acc Id:

ENSRNOP00000011521 ⟸ ENSRNOT00000011521

Ensembl Acc Id:

ENSRNOP00000074720 ⟸ ENSRNOT00000083560

Protein Domains

Glycosyl hydrolase family 63 C-terminal Glycosyl hydrolase family 63 N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2K8S6-F1-model_v2	AlphaFold	A0A0G2K8S6	1-834	view protein structure
AF-O88941-F1-model_v2	AlphaFold	O88941	1-834	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69240	AgrOrtholog
BioCyc Gene	G2FUF-44025	BioCyc
BioCyc Pathway	PWY-7919 [protein N-glycosylation processing phase (plants and animals)]	BioCyc
BioCyc Pathway Image	PWY-7919	BioCyc
Ensembl Genes	ENSRNOG00000008648	Ensembl
	ENSRNOG00000054176	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000083560.2	UniProtKB/TrEMBL
Gene3D-CATH	1.50.10.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	2.70.98.110	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	6-hairpin_glycosidase_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	6hp_glycosidase-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Glyco_hydro_63_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Glyco_hydro_63N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Glyco_hydro_63N_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Glycoside_hydrolase_63	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:78947	UniProtKB/Swiss-Prot
NCBI Gene	Mogs	ENTREZGENE
PANTHER	MANNOSYL-OLIGOSACCHARIDE GLUCOSIDASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR10412	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Glyco_hydro_63	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Glyco_hydro_63N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Mogs	PhenoGen
RatGTEx	ENSRNOG00000008648	RatGTEx
	ENSRNOG00000054176	RatGTEx
Superfamily-SCOP	SSF48208	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC228437
UniProt	A0A0G2K8S6	ENTREZGENE, UniProtKB/TrEMBL
	A6IAK3	ENTREZGENE, UniProtKB/TrEMBL
	MOGS_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Mogs	mannosyl-oligosaccharide glucosidase	LOC103692171	mannosyl-oligosaccharide glucosidase	Data merged from RGD:9236907	737654	PROVISIONAL
2014-08-25	LOC103692171	mannosyl-oligosaccharide glucosidase			Symbol and Name status set to provisional	70820	PROVISIONAL
2012-01-25	Mogs	mannosyl-oligosaccharide glucosidase	Gcs1	glucosidase 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2003-04-09	Gcs1	glucosidase 1			Symbol and Name updated	629477	APPROVED
2003-03-10	Gcs1	glucosidase 1	Gcs1-pending	glucosidase 1	Data merged from RGD:619927	628472	PROVISIONAL
2002-08-07	Gcs1-pending	glucosidase 1			Symbol and Name status set to provisional	70820	PROVISIONAL
2002-06-10	Gcs1	glucosidase 1			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

BioCyc Pathways