Symbol:
Cd82
Name:
Cd82 molecule
RGD ID:
69070
Description:
Predicted to be located in membrane. Predicted to be active in plasma membrane. Biomarker of hypertension and ovarian cancer. Orthologous to human CD82 (CD82 molecule); PARTICIPATES IN p53 signaling pathway; INTERACTS WITH 1,2,4-trimethylbenzene; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
CD82 antigen; CD82 antigen (R2 leukocyte antigen antigen detected by monoclonal and antibody IA4)); CD82 antigen (R2 leukocyte antigen, antigen detected by monoclonal and antibody IA4)); Kai1; kangai 1; Kangai 1 (suppression of tumerigenicity 6 prostate) CD82 antigen; Kangai 1 (suppression of tumerigenicity 6, prostate) CD82 antigen; kangai 1 (suppression of tumorigenicity 6) prostate; kangai 1 (suppression of tumorigenicity 6), prostate; Kangai 1 (suppression of tumorigenicity 6, prostate, CD82 antigen (R2 leukocyte antigen, antigen detected by monoclonal and antibody IA4)); metastasis suppressor Kangai-1 homolog
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CD82 (CD82 molecule) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
Cd82 (CD82 antigen) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cd82 (CD82 molecule) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CD82 (CD82 molecule) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CD82 (CD82 molecule) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cd82 (CD82 molecule) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CD82 (CD82 molecule) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CD82 (CD82 molecule) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cd82 (CD82 molecule) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
SLC27A6 (solute carrier family 27 member 6) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
CD82 (CD82 molecule)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Cd82 (CD82 antigen)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cd82b (CD82 molecule b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cd82a (CD82 molecule a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Tsp39D
Alliance
DIOPT (Ensembl Compara|OMA|PANTHER)
Drosophila melanogaster (fruit fly):
Tsp96F
Alliance
DIOPT (InParanoid|OMA|PANTHER)
Drosophila melanogaster (fruit fly):
Tsp66E
Alliance
DIOPT (Ensembl Compara|OMA|PANTHER)
Caenorhabditis elegans (roundworm):
tsp-4
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
cd82
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 99,842,748 - 99,887,298 (-) NCBI GRCr8 mRatBN7.2 3 79,387,361 - 79,431,847 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 79,385,887 - 79,431,809 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 82,861,325 - 82,905,239 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 91,460,386 - 91,504,299 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 89,311,775 - 89,356,142 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 82,324,344 - 82,368,846 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 82,324,354 - 82,368,357 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 89,026,114 - 89,070,616 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 77,831,771 - 77,875,764 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 77,728,200 - 77,772,102 (-) NCBI Celera 3 78,589,536 - 78,633,414 (-) NCBI Celera Cytogenetic Map 3 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cd82 Rat 1,2,4-trimethylbenzene decreases expression EXP 6480464 pseudocumene results in decreased expression of CD82 protein CTD PMID:17337753 Cd82 Rat 1,2-dichloroethane decreases expression ISO Cd82 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of CD82 mRNA CTD PMID:28960355 Cd82 Rat 17beta-estradiol multiple interactions ISO CD82 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of CD82 mRNA and Estradiol promotes the reaction [Tetrachlorodibenzodioxin results in decreased expression of CD82 protein] CTD PMID:21685244 and PMID:30165855 Cd82 Rat 17beta-estradiol increases expression ISO Cd82 (Mus musculus) 6480464 Estradiol results in increased expression of CD82 mRNA CTD PMID:39298647 Cd82 Rat 17beta-estradiol decreases expression ISO CD82 (Homo sapiens) 6480464 Estradiol results in decreased expression of CD82 protein CTD PMID:21685244 Cd82 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cd82 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CD82 mRNA CTD PMID:21570461 Cd82 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Cd82 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of CD82 mRNA CTD PMID:33956508 Cd82 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CD82 mRNA CTD PMID:32109520 and PMID:34747641 Cd82 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO CD82 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of CD82 protein CTD PMID:21685244 Cd82 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO CD82 (Homo sapiens) 6480464 Estradiol promotes the reaction [Tetrachlorodibenzodioxin results in decreased expression of CD82 protein] CTD PMID:21685244 Cd82 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of CD82 mRNA CTD PMID:21346803 Cd82 Rat 2,6-dimethoxyphenol multiple interactions ISO CD82 (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Cd82 Rat 2-palmitoylglycerol increases expression ISO CD82 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of CD82 mRNA CTD PMID:37199045 Cd82 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Cd82 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of CD82 mRNA CTD PMID:20188158 Cd82 Rat 4,4'-sulfonyldiphenol increases expression ISO Cd82 (Mus musculus) 6480464 bisphenol S results in increased expression of CD82 mRNA CTD PMID:30951980 Cd82 Rat 4,4'-sulfonyldiphenol decreases expression ISO Cd82 (Mus musculus) 6480464 bisphenol S results in decreased expression of CD82 mRNA CTD PMID:39298647 Cd82 Rat 4-hydroxyphenyl retinamide increases expression ISO Cd82 (Mus musculus) 6480464 Fenretinide results in increased expression of CD82 mRNA CTD PMID:28973697 Cd82 Rat 4-nitrophenol increases expression ISO Cd82 (Mus musculus) 6480464 4-nitrophenol results in increased expression of CD82 mRNA CTD PMID:34673133 Cd82 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of CD82 mRNA CTD PMID:30047161 Cd82 Rat acrylamide decreases expression ISO CD82 (Homo sapiens) 6480464 Acrylamide results in decreased expression of CD82 mRNA CTD PMID:32763439 Cd82 Rat actinomycin D multiple interactions ISO CD82 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of and results in increased secretion of CD82 protein and [Dactinomycin co-treated with nutlin 3] results in increased expression of CD82 mRNA CTD PMID:38460933 Cd82 Rat actinomycin D increases expression ISO CD82 (Homo sapiens) 6480464 Dactinomycin results in increased expression of CD82 mRNA CTD PMID:38460933 Cd82 Rat Aflatoxin B2 alpha decreases methylation ISO CD82 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of CD82 intron CTD PMID:30157460 Cd82 Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of CD82 mRNA CTD PMID:20488242 Cd82 Rat all-trans-retinoic acid increases expression ISO CD82 (Homo sapiens) 6480464 Tretinoin results in increased expression of CD82 mRNA CTD PMID:33167477 Cd82 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of CD82 mRNA CTD PMID:30047161 Cd82 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CD82 mRNA CTD PMID:16483693 Cd82 Rat antirheumatic drug decreases expression ISO CD82 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of CD82 mRNA CTD PMID:24449571 Cd82 Rat aristolochic acid A increases expression ISO CD82 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of CD82 mRNA CTD PMID:33212167 Cd82 Rat arsane multiple interactions ISO CD82 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of CD82 mRNA CTD PMID:39836092 Cd82 Rat arsenic atom multiple interactions ISO CD82 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of CD82 mRNA CTD PMID:39836092 Cd82 Rat benzo[a]pyrene affects methylation ISO CD82 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of CD82 5' UTR CTD PMID:27901495 Cd82 Rat benzo[a]pyrene decreases methylation ISO CD82 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of CD82 promoter CTD PMID:27901495 Cd82 Rat benzo[e]pyrene increases methylation ISO CD82 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of CD82 intron CTD PMID:30157460 Cd82 Rat bis(2-ethylhexyl) phthalate increases expression ISO Cd82 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of CD82 mRNA CTD PMID:33754040 Cd82 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CD82 mRNA CTD PMID:25181051 Cd82 Rat bisphenol A decreases methylation ISO CD82 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of CD82 gene CTD PMID:31601247 Cd82 Rat bisphenol A increases expression ISO Cd82 (Mus musculus) 6480464 bisphenol A results in increased expression of CD82 mRNA CTD PMID:32156529 and PMID:34585602 Cd82 Rat bisphenol A decreases expression ISO CD82 (Homo sapiens) 6480464 bisphenol A results in decreased expression of CD82 protein CTD PMID:33376534 Cd82 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CD82 mRNA CTD PMID:30816183 more ... Cd82 Rat bisphenol F increases expression ISO Cd82 (Mus musculus) 6480464 bisphenol F results in increased expression of CD82 mRNA CTD PMID:30951980 Cd82 Rat bortezomib decreases expression ISO CD82 (Homo sapiens) 6480464 Bortezomib results in decreased expression of CD82 mRNA CTD PMID:20977926 Cd82 Rat butanal increases expression ISO CD82 (Homo sapiens) 6480464 butyraldehyde results in increased expression of CD82 mRNA CTD PMID:26079696 Cd82 Rat calcitriol increases expression ISO CD82 (Homo sapiens) 6480464 Calcitriol results in increased expression of CD82 mRNA CTD PMID:21592394 Cd82 Rat calcitriol multiple interactions ISO CD82 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of CD82 mRNA CTD PMID:21592394 Cd82 Rat camptothecin increases expression ISO CD82 (Homo sapiens) 6480464 Camptothecin results in increased expression of CD82 mRNA CTD PMID:38460933 Cd82 Rat cannabidiol decreases expression ISO CD82 (Homo sapiens) 6480464 Cannabidiol results in decreased expression of CD82 mRNA CTD PMID:27932991 Cd82 Rat carbon nanotube decreases expression ISO Cd82 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Cd82 Rat chlorpyrifos increases expression ISO Cd82 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of CD82 mRNA CTD PMID:32715474 Cd82 Rat cisplatin multiple interactions ISO CD82 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of CD82 mRNA CTD PMID:27392435 Cd82 Rat cisplatin increases expression ISO CD82 (Homo sapiens) 6480464 Cisplatin results in increased expression of CD82 mRNA CTD PMID:27392435 and PMID:27594783 Cd82 Rat clofibrate decreases expression ISO Cd82 (Mus musculus) 6480464 Clofibrate results in decreased expression of CD82 mRNA CTD PMID:23811191 Cd82 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of CD82 mRNA CTD PMID:26577399 and PMID:27523638 Cd82 Rat dibutyl phthalate increases expression ISO Cd82 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of CD82 mRNA CTD PMID:21266533 Cd82 Rat diquat increases expression ISO Cd82 (Mus musculus) 6480464 Diquat results in increased expression of CD82 protein CTD PMID:36851058 Cd82 Rat dorsomorphin multiple interactions ISO CD82 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CD82 mRNA CTD PMID:27188386 Cd82 Rat doxorubicin decreases expression ISO CD82 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of CD82 mRNA CTD PMID:29803840 Cd82 Rat epoxiconazole decreases expression ISO Cd82 (Mus musculus) 6480464 epoxiconazole results in decreased expression of CD82 mRNA CTD PMID:35436446 Cd82 Rat fenthion increases expression ISO Cd82 (Mus musculus) 6480464 Fenthion results in increased expression of CD82 mRNA CTD PMID:34813904 Cd82 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of CD82 mRNA CTD PMID:24136188 Cd82 Rat formaldehyde increases expression ISO CD82 (Homo sapiens) 6480464 Formaldehyde results in increased expression of CD82 mRNA CTD PMID:23649840 Cd82 Rat furfural multiple interactions ISO CD82 (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Cd82 Rat genistein increases expression ISO CD82 (Homo sapiens) 6480464 Genistein results in increased expression of CD82 mRNA CTD PMID:18847459 Cd82 Rat L-ascorbic acid increases expression EXP 6480464 Ascorbic Acid results in increased expression of CD82 mRNA CTD PMID:15372504 Cd82 Rat lead(0) decreases expression ISO CD82 (Homo sapiens) 6480464 Lead results in decreased expression of CD82 mRNA CTD PMID:19921347 Cd82 Rat manganese atom multiple interactions ISO CD82 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of CD82 mRNA CTD PMID:39836092 Cd82 Rat manganese(0) multiple interactions ISO CD82 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of CD82 mRNA CTD PMID:39836092 Cd82 Rat manganese(II) chloride multiple interactions ISO CD82 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of CD82 mRNA CTD PMID:39836092 Cd82 Rat mercury dibromide decreases expression ISO CD82 (Homo sapiens) 6480464 mercuric bromide results in decreased expression of CD82 mRNA CTD PMID:26272509 Cd82 Rat methapyrilene increases methylation ISO CD82 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of CD82 intron CTD PMID:30157460 Cd82 Rat methidathion increases expression ISO Cd82 (Mus musculus) 6480464 methidathion results in increased expression of CD82 mRNA CTD PMID:34813904 Cd82 Rat methylmercury chloride decreases expression ISO CD82 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of CD82 mRNA CTD PMID:28001369 Cd82 Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of CD82 mRNA CTD PMID:24136188 Cd82 Rat nickel sulfate increases expression ISO CD82 (Homo sapiens) 6480464 nickel sulfate results in increased expression of CD82 mRNA CTD PMID:22714537 Cd82 Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of CD82 mRNA CTD PMID:24136188 Cd82 Rat Nutlin-3 increases expression ISO CD82 (Homo sapiens) 6480464 nutlin 3 results in increased expression of CD82 mRNA CTD PMID:38460933 Cd82 Rat Nutlin-3 multiple interactions ISO CD82 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of and results in increased secretion of CD82 protein and [Dactinomycin co-treated with nutlin 3] results in increased expression of CD82 mRNA CTD PMID:38460933 Cd82 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of CD82 mRNA CTD PMID:25729387 Cd82 Rat p-chloromercuribenzoic acid decreases expression ISO CD82 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in decreased expression of CD82 mRNA CTD PMID:26272509 Cd82 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of CD82 mRNA CTD PMID:33387578 Cd82 Rat pentachlorophenol decreases expression ISO Cd82 (Mus musculus) 6480464 Pentachlorophenol results in decreased expression of CD82 mRNA CTD PMID:23892564 Cd82 Rat pentanal increases expression ISO CD82 (Homo sapiens) 6480464 pentanal results in increased expression of CD82 mRNA CTD PMID:26079696 Cd82 Rat perfluorohexanesulfonic acid decreases expression ISO Cd82 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of CD82 mRNA CTD PMID:37995155 Cd82 Rat perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of CD82 mRNA CTD PMID:19162173 Cd82 Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of CD82 mRNA CTD PMID:19162173 Cd82 Rat phenethyl isothiocyanate increases expression ISO CD82 (Homo sapiens) 6480464 phenethyl isothiocyanate results in increased expression of CD82 mRNA CTD PMID:26678675 Cd82 Rat pirinixic acid decreases expression ISO Cd82 (Mus musculus) 6480464 pirinixic acid results in decreased expression of CD82 mRNA CTD PMID:17426115 and PMID:23811191 Cd82 Rat potassium chromate increases expression ISO CD82 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of CD82 mRNA CTD PMID:22714537 Cd82 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of CD82 mRNA CTD PMID:19162173 Cd82 Rat propanal increases expression ISO CD82 (Homo sapiens) 6480464 propionaldehyde results in increased expression of CD82 mRNA CTD PMID:26079696 Cd82 Rat SB 431542 multiple interactions ISO CD82 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CD82 mRNA CTD PMID:27188386 Cd82 Rat silicon dioxide decreases expression ISO CD82 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of CD82 mRNA CTD PMID:25895662 Cd82 Rat sodium arsenite decreases expression ISO CD82 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of CD82 mRNA CTD PMID:38568856 Cd82 Rat sodium arsenite multiple interactions ISO CD82 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of CD82 mRNA CTD PMID:39836092 Cd82 Rat sodium chloride multiple interactions ISO CD82 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of CD82 protein more ... CTD PMID:38598786 Cd82 Rat Soman increases expression EXP 6480464 Soman results in increased expression of CD82 mRNA CTD PMID:19281266 Cd82 Rat sotorasib multiple interactions ISO CD82 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of CD82 mRNA CTD PMID:36139627 Cd82 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of CD82 mRNA CTD PMID:30047161 Cd82 Rat sulforaphane decreases expression ISO CD82 (Homo sapiens) 6480464 sulforaphane results in decreased expression of CD82 mRNA CTD PMID:31838189 Cd82 Rat temozolomide decreases expression ISO CD82 (Homo sapiens) 6480464 Temozolomide results in decreased expression of CD82 mRNA CTD PMID:31758290 Cd82 Rat Terfenadine increases expression ISO CD82 (Homo sapiens) 6480464 Terfenadine analog results in increased expression of CD82 protein CTD PMID:19289568 Cd82 Rat Terfenadine multiple interactions ISO CD82 (Homo sapiens) 6480464 11 more ... CTD PMID:19289568 Cd82 Rat tert-butyl hydroperoxide increases expression ISO CD82 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of CD82 mRNA CTD PMID:15336504 Cd82 Rat testosterone multiple interactions ISO CD82 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of CD82 mRNA CTD PMID:21592394 Cd82 Rat testosterone increases expression ISO CD82 (Homo sapiens) 6480464 Testosterone results in increased expression of CD82 mRNA CTD PMID:21592394 Cd82 Rat tetrachloromethane decreases expression ISO Cd82 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of CD82 mRNA CTD PMID:17484886 Cd82 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of CD82 mRNA CTD PMID:25729387 Cd82 Rat trametinib multiple interactions ISO CD82 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of CD82 mRNA CTD PMID:36139627 Cd82 Rat triphenyl phosphate affects expression ISO CD82 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of CD82 mRNA CTD PMID:37042841 Cd82 Rat undecane decreases expression EXP 6480464 undecane results in decreased expression of CD82 protein CTD PMID:17337753 Cd82 Rat valproic acid affects expression ISO CD82 (Homo sapiens) 6480464 Valproic Acid affects the expression of CD82 mRNA CTD PMID:25979313 Cd82 Rat valproic acid increases expression ISO CD82 (Homo sapiens) 6480464 Valproic Acid results in increased expression of CD82 mRNA CTD PMID:29154799 Cd82 Rat valproic acid decreases expression ISO CD82 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of CD82 mRNA CTD PMID:26272509 Cd82 Rat valproic acid multiple interactions ISO CD82 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CD82 mRNA CTD PMID:27188386
Imported Annotations - KEGG (archival)
1,2,4-trimethylbenzene (EXP) 1,2-dichloroethane (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2-palmitoylglycerol (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 4-nitrophenol (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (ISO) actinomycin D (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (EXP,ISO) amitrole (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bortezomib (ISO) butanal (ISO) calcitriol (ISO) camptothecin (ISO) cannabidiol (ISO) carbon nanotube (ISO) chlorpyrifos (ISO) cisplatin (ISO) clofibrate (ISO) Cuprizon (EXP) dibutyl phthalate (ISO) diquat (ISO) dorsomorphin (ISO) doxorubicin (ISO) epoxiconazole (ISO) fenthion (ISO) flutamide (EXP) formaldehyde (ISO) furfural (ISO) genistein (ISO) L-ascorbic acid (EXP) lead(0) (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) mercury dibromide (ISO) methapyrilene (ISO) methidathion (ISO) methylmercury chloride (ISO) nefazodone (EXP) nickel sulfate (ISO) nimesulide (EXP) Nutlin-3 (ISO) oxaliplatin (EXP) p-chloromercuribenzoic acid (ISO) paracetamol (EXP) pentachlorophenol (ISO) pentanal (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (EXP) perfluorooctanoic acid (EXP) phenethyl isothiocyanate (ISO) pirinixic acid (ISO) potassium chromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) propanal (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium chloride (ISO) Soman (EXP) sotorasib (ISO) sulfadimethoxine (EXP) sulforaphane (ISO) temozolomide (ISO) Terfenadine (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) tetrachloromethane (ISO) topotecan (EXP) trametinib (ISO) triphenyl phosphate (ISO) undecane (EXP) valproic acid (ISO)
1.
Expression of KAI1/CD82 and MRP-1/CD9 in transitional cell carcinoma of bladder.
Ai X, etal., J Huazhong Univ Sci Technolog Med Sci. 2007 Feb;27(1):79-82.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Frequent loss of KAI1 expression in squamous and lymphoid neoplasms. An immunohistochemical study of archival tissues.
Geradts J, etal., Am J Pathol 1999 Jun;154(6):1665-71.
4.
Loss of expression and altered localization of KAI1 and CD9 protein are associated with epithelial ovarian cancer progression.
Houle CD, etal., Gynecol Oncol. 2002 Jul;86(1):69-78.
5.
Aberrant expression of novel and previously described cell membrane markers in human breast cancer cell lines and tumors.
Huang H, etal., Clin Cancer Res. 2005 Jun 15;11(12):4357-64.
6.
Downregulation of KAI1 mRNA in localised prostate cancer and its bony metastases does not correlate with p53 overexpression.
Jackson P, etal., Prostate Cancer Prostatic Dis. 2003;6(2):174-81.
7.
Location of KAI1 on the short arm of human chromosome 11 and frequency of allelic loss in advanced human prostate cancer.
Kawana Y, etal., Prostate. 1997 Aug 1;32(3):205-13.
8.
KAI1 metastasis suppressor protein is down-regulated during the progression of human endometrial cancer.
Liu FS, etal., Clin Cancer Res. 2003 Apr;9(4):1393-8.
9.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
10.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.
Establishment of rat hepatocellular carcinoma cell lines with differing metastatic potential in nude mice.
Ogawa K, etal., Int J Cancer. 2001 Mar 15;91(6):797-802.
12.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
13.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
14.
GOA pipeline
RGD automated data pipeline
15.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
17.
Comprehensive gene review and curation
RGD comprehensive gene curation
18.
Protein networking in bladder cancer: immunoreactivity for FGFR3, EGFR, ERBB2, KAI1, PTEN, and RAS in normal and malignant urothelium.
Rotterud R, etal., Histol Histopathol. 2007 Apr;22(4):349-63.
19.
Reduced metastasis-suppressor gene mRNA-expression in breast cancer brain metastases.
Stark AM, etal., J Cancer Res Clin Oncol. 2005 Mar;131(3):191-8. Epub 2004 Dec 8.
20.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
21.
Decreased expression of KAI1 metastasis suppressor gene is a recurrence predictor in primary pTa and pT1 urothelial bladder carcinoma.
Su JS, etal., Int J Urol. 2004 Feb;11(2):74-82.
22.
Identification of the rat homologue of KAI1 and its expression in Dunning rat prostate cancers.
Suzuki H, etal., Prostate 1998 Dec 1;37(4):253-60.
23.
Localization of 54 rat genes, and definition of new synteny groups conserved in the human and the rat.
Szpirer C, etal., Mamm Genome 2000 Sep;11(9):729-35
24.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
25.
KAI1 expression can be a predictor of stage A prostate cancer progression.
Tozawa K, etal., Prostate Cancer Prostatic Dis. 2001;4(3):150-153.
26.
Temporal changes in gene expression after injury in the rat retina.
Vazquez-Chona F, etal., Invest Ophthalmol Vis Sci. 2004 Aug;45(8):2737-46.
27.
[Expression of metastasis suppressor gene KAI1/CD82 in cervical squamous cell carcinoma and its clinical significance.]
Xiong Y, etal., Ai Zheng. 2005 Jan;24(1):110-5.
28.
Identification of upregulated genes in the thymus of spontaneously hypertensive rats by cDNA representational difference analysis.
Zhao XS, etal., Blood Press. 1998 Nov;7(5-6):316-23.
Cd82 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 99,842,748 - 99,887,298 (-) NCBI GRCr8 mRatBN7.2 3 79,387,361 - 79,431,847 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 79,385,887 - 79,431,809 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 82,861,325 - 82,905,239 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 91,460,386 - 91,504,299 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 89,311,775 - 89,356,142 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 82,324,344 - 82,368,846 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 82,324,354 - 82,368,357 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 89,026,114 - 89,070,616 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 77,831,771 - 77,875,764 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 77,728,200 - 77,772,102 (-) NCBI Celera 3 78,589,536 - 78,633,414 (-) NCBI Celera Cytogenetic Map 3 q31 NCBI
CD82 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 44,564,409 - 44,620,358 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 44,564,427 - 44,620,363 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 44,587,213 - 44,641,908 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 44,543,717 - 44,597,915 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 11 44,734,291 - 44,788,479 (+) NCBI Celera Cytogenetic Map 11 p11.2 NCBI HuRef 11 44,296,423 - 44,350,592 (+) NCBI HuRef CHM1_1 11 44,585,957 - 44,640,111 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 44,720,425 - 44,776,379 (+) NCBI T2T-CHM13v2.0
Cd82 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 93,249,447 - 93,293,295 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 93,249,456 - 93,293,485 (-) Ensembl GRCm39 Ensembl GRCm38 2 93,419,102 - 93,462,950 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 93,419,111 - 93,463,140 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 93,259,269 - 93,303,103 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 93,219,951 - 93,263,335 (-) NCBI MGSCv36 mm8 Celera 2 94,814,780 - 94,859,821 (-) NCBI Celera Cytogenetic Map 2 E1 NCBI cM Map 2 51.62 NCBI
Cd82 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955422 3,033,133 - 3,052,153 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955422 3,035,887 - 3,069,298 (-) NCBI ChiLan1.0 ChiLan1.0
CD82 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 46,780,583 - 46,836,160 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 46,786,918 - 46,842,472 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 44,526,010 - 44,581,560 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 45,020,362 - 45,075,876 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 45,020,319 - 45,075,876 (+) Ensembl panpan1.1 panPan2
CD82 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 18 44,658,414 - 44,707,897 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 18 44,659,180 - 44,706,768 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 ROS_Cfam_1.0 18 45,317,202 - 45,369,506 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 45,317,220 - 45,368,392 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 44,800,179 - 44,851,496 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 44,353,829 - 44,406,031 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 45,086,983 - 45,139,553 (-) NCBI UU_Cfam_GSD_1.0
Cd82 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 21,960,790 - 21,973,529 (-) NCBI HiC_Itri_2
CD82 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 17,750,660 - 17,803,126 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 17,751,153 - 17,803,172 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 19,249,749 - 19,264,391 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CD82 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 20,736,216 - 20,793,943 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 20,735,287 - 20,763,160 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 117,969,772 - 118,024,761 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cd82
.
Predicted Target Of
Count of predictions: 393 Count of miRNA genes: 215 Interacting mature miRNAs: 252 Transcripts: ENSRNOT00000000052 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300178 Hrtrt4 Heart rate QTL 4 3.74 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 43827364 90905114 Rat 61377 Edpm3 Estrogen-dependent pituitary mass QTL 3 7.05 0.038 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 53184692 89878207 Rat 2301414 Kidm37 Kidney mass QTL 37 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 70653097 121056321 Rat 1582238 Bw68 Body weight QTL 68 3.2 0.0064 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 1331795 Rf30 Renal function QTL 30 3.708 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 3 39454637 89115240 Rat 1582239 Epfw1 Epididymal fat weight QTL 1 4.5 0.0006 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 3 53184593 115665732 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 737818 Hcar12 Hepatocarcinoma resistance QTL 12 2.6 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 3 29463235 118376539 Rat 1582218 Bw74 Body weight QTL 74 3.9 0.0021 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 1331777 Bw24 Body weight QTL 24 3.503 body mass (VT:0001259) body weight (CMO:0000012) 3 39454637 89115240 Rat 1582221 Kidm30 Kidney mass QTL 30 3.5 0.0008 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 3 64655305 115665732 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 1582210 Bw71 Body weight QTL 71 3.3 0.0012 body mass (VT:0001259) body weight (CMO:0000012) 3 64655305 115665732 Rat 1300111 Rf12 Renal function QTL 12 3.78 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 61017749 121056321 Rat 724523 Tsu1 Thymus enlargement suppressive QTL 1 3.84 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 3 50437504 115638231 Rat 1600376 Arunc5 Aerobic running capacity QTL 5 0.21 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 3 73376539 118376539 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1581503 Cm58 Cardiac mass QTL 58 2.7 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 43827364 121056321 Rat 2292613 Ept16 Estrogen-induced pituitary tumorigenesis QTL 16 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat 731180 Bp152 Blood pressure QTL 152 0.03 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 53781112 91609953 Rat 738019 Anxrr10 Anxiety related response QTL 10 3.9 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 3 38517803 83517803 Rat 631200 Cm25 Cardiac mass QTL 25 4.8 0.0001 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 3 61134348 89115068 Rat 61419 Cia11 Collagen induced arthritis QTL 11 5.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 3 30356773 98535386 Rat 12879848 Bw181 Body weght QTL 181 0.015 body mass (VT:0001259) body weight (CMO:0000012) 3 70348525 121056321 Rat 1358905 Hrtrt17 Heart rate QTL 17 5.9 0.000014 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 10861912 89878372 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 1354597 Kidm13 Kidney mass QTL 13 2.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 3 41874578 104104347 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 2290452 Scl56 Serum cholesterol level QTL 56 2.26 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 3 1 91609953 Rat 1354604 Bw36 Body weight QTL 36 2.9 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 104104347 Rat 631665 Bw8 Body weight QTL 8 5.5 body mass (VT:0001259) body weight (CMO:0000012) 3 50437042 119183768 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 1358186 Ept2 Estrogen-induced pituitary tumorigenesis QTL 2 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat
RH127894
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 79,387,524 - 79,387,715 (+) MAPPER mRatBN7.2 Rnor_6.0 3 82,324,509 - 82,324,699 NCBI Rnor6.0 Rnor_5.0 3 89,026,279 - 89,026,469 UniSTS Rnor5.0 RGSC_v3.4 3 77,831,931 - 77,832,121 UniSTS RGSC3.4 Celera 3 78,589,696 - 78,589,886 UniSTS RH 3.4 Map 3 685.5 UniSTS Cytogenetic Map 3 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000000052 ⟹ ENSRNOP00000000052
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 79,387,361 - 79,431,782 (-) Ensembl Rnor_6.0 Ensembl 3 82,324,354 - 82,368,357 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000097921 ⟹ ENSRNOP00000078723
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 79,387,367 - 79,431,310 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000100406 ⟹ ENSRNOP00000084636
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 79,387,367 - 79,431,311 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000119233 ⟹ ENSRNOP00000091451
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 79,385,887 - 79,431,809 (-) Ensembl
RefSeq Acc Id:
NM_031797 ⟹ NP_113985
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 99,842,752 - 99,886,744 (-) NCBI mRatBN7.2 3 79,387,365 - 79,431,358 (-) NCBI Rnor_6.0 3 82,324,349 - 82,368,357 (-) NCBI Rnor_5.0 3 89,026,114 - 89,070,616 (-) NCBI RGSC_v3.4 3 77,831,771 - 77,875,764 (-) RGD Celera 3 78,589,536 - 78,633,414 (-) RGD
Sequence:
CGTGGCCTGACAAGGCCGTTGAGCTTCTGGACTGACTTCGGGAGGGGGTTGCCGGGGAGAGCAAAGGGACAGAGCCAAGCTGCGCAGTCAAACACGGGTTGGGGCGGCAGCTGAAGACGCCAACTTAA
hide sequence
RefSeq Acc Id:
XM_006234597 ⟹ XP_006234659
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 99,842,748 - 99,887,208 (-) NCBI mRatBN7.2 3 79,387,370 - 79,431,805 (-) NCBI Rnor_6.0 3 82,324,344 - 82,368,794 (-) NCBI Rnor_5.0 3 89,026,114 - 89,070,616 (-) NCBI
Sequence:
CTTTGGGGAAAGTGCTGGAGGCAAAGGGGTGAACGGGAGGGCTTCGGAGGACCGCCGGCGGCCT
hide sequence
RefSeq Acc Id:
XM_006234598 ⟹ XP_006234660
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 99,842,748 - 99,887,298 (-) NCBI mRatBN7.2 3 79,387,370 - 79,431,847 (-) NCBI Rnor_6.0 3 82,324,344 - 82,368,846 (-) NCBI Rnor_5.0 3 89,026,114 - 89,070,616 (-) NCBI
Sequence:
GAATCCACGGGAGGGGCGGAGCCAGAGAGTTGCCTCCCAGTTGGTGTGTCCATTGTCCAGAACT
hide sequence
RefSeq Acc Id:
XM_039105948 ⟹ XP_038961876
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 99,842,748 - 99,861,087 (-) NCBI mRatBN7.2 3 79,387,370 - 79,405,697 (-) NCBI
RefSeq Acc Id:
XM_039105951 ⟹ XP_038961879
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 99,842,748 - 99,850,372 (-) NCBI mRatBN7.2 3 79,387,361 - 79,394,473 (-) NCBI
RefSeq Acc Id:
XM_039105953 ⟹ XP_038961881
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 99,842,748 - 99,849,601 (-) NCBI mRatBN7.2 3 79,387,361 - 79,394,209 (-) NCBI
RefSeq Acc Id:
NP_113985 ⟸ NM_031797
- UniProtKB:
O70352 (UniProtKB/Swiss-Prot), Q6IN14 (UniProtKB/TrEMBL), A6HNI9 (UniProtKB/TrEMBL), F7EV99 (UniProtKB/TrEMBL), A0A8I5ZZR7 (UniProtKB/TrEMBL)
- Sequence:
MGAGCVKVTKYFLFLFNLLFFILGAVILGFGVWILADKSSFISVLQTSSSSLQVGAYVFIGVGAITMLMGFLGCIGAVNEVRCLLGLYFVFLLLILIAQVTVGVLFYFNADKLKQEMGNTVMDIIQNY
hide sequence
RefSeq Acc Id:
XP_006234660 ⟸ XM_006234598
- Peptide Label:
isoform X1
- Sequence:
MGAGCVKVTKYFLFLFNLLFFILGAVILGFGVWILADKSSFISVLQTSSSSLQVGAYVFIGVGA
hide sequence
RefSeq Acc Id:
XP_006234659 ⟸ XM_006234597
- Peptide Label:
isoform X1
- Sequence:
MGAGCVKVTKYFLFLFNLLFFILGAVILGFGVWILADKSSFISVLQTSSSSLQVGAYVFIGVGAITMLMGFLGCIGAVNEVRCLLGLYFVFLLLILIAQVTVGVLFYFNADKLKQEMGNTVMDIIQNY
hide sequence
Ensembl Acc Id:
ENSRNOP00000000052 ⟸ ENSRNOT00000000052
RefSeq Acc Id:
XP_038961879 ⟸ XM_039105951
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038961881 ⟸ XM_039105953
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038961876 ⟸ XM_039105948
- Peptide Label:
isoform X2
- UniProtKB:
A6HNJ0 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000078723 ⟸ ENSRNOT00000097921
Ensembl Acc Id:
ENSRNOP00000084636 ⟸ ENSRNOT00000100406
Ensembl Acc Id:
ENSRNOP00000091451 ⟸ ENSRNOT00000119233
RGD ID: 13692232 Promoter ID: EPDNEW_R2756 Type: initiation region Name: Cd82_1 Description: Cd82 molecule SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 82,368,340 - 82,368,400 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-09-29
Cd82
Cd82 molecule
Cd82
CD82 antigen
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Cd82
CD82 antigen
Kai1
kangai 1
Symbol and Name updated
1299863 APPROVED
2004-12-14
Kai1
kangai 1
Symbol and Name status set to approved
1299863 APPROVED
2002-06-10
Kai1
kangai 1
Name updated
70585 PROVISIONAL
Note Type
Note
Reference
gene_disease
down-regulated in squamous cell carcinomas
68869
gene_disease
down-regulated in squamous cell carcinomas
70284
gene_disease
2.0-kb mRNA is associated with high metastatic ability by prostate cancer cells; 1.8-kb transcript is upregulated but not associated with metastasis
68869
gene_disease
2.0-kb mRNA is associated with high metastatic ability by prostate cancer cells; 1.8-kb transcript is upregulated but not associated with metastasis
70284
gene_disease
expression not found in some low-grade and high-grade lymphomas
68869
gene_disease
expression not found in some low-grade and high-grade lymphomas
70284
gene_expression
expressed in squamous cell carcinomas
68869
gene_expression
expressed in squamous cell carcinomas
70284
gene_process
suppresses the metastatic potential of prostate cancer cells
68869
gene_process
suppresses the metastatic potential of prostate cancer cells
70284
gene_product
glycoprotein that belongs to the transmembrane 4 superfamily (TM4SF)
68869
gene_product
glycoprotein that belongs to the transmembrane 4 superfamily (TM4SF)
70284
gene_transcript
expresses a predominant 2.0-kb and a minor 1.8-kb-sized RNA
70284
