Symbol:
Dclk1
Name:
doublecortin-like kinase 1
RGD ID:
68437
Description:
Enables protein kinase activity. Involved in protein phosphorylation. Located in growth cone. Orthologous to human DCLK1 (doublecortin like kinase 1); INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 17beta-estradiol 3-benzoate.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
activity and neurotransmitter-induced early gene protein 4 (ania-4); Ania4; calcium/calmodulin-dependent protein kinase type I-like CPG16; Cpg16; Dcamkl1; double cortin and calcium/calmodulin-dependent protein kinase-like 1; doublecortin-like and CAM kinase-like 1; serine/threonine-protein kinase DCLK1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 141,567,215 - 141,861,088 (+) NCBI GRCr8 mRatBN7.2 2 139,417,234 - 139,710,956 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 139,417,163 - 139,710,956 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 146,207,364 - 146,283,054 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 144,318,813 - 144,394,500 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 138,951,229 - 139,026,915 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 144,646,255 - 144,939,389 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 144,646,308 - 144,936,927 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 164,062,498 - 164,355,201 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 144,678,222 - 144,754,237 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 144,628,184 - 144,704,200 (+) NCBI Celera 2 134,114,211 - 134,191,878 (+) NCBI Celera Cytogenetic Map 2 q26 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Dclk1 Rat 1,2-dimethylhydrazine decreases expression ISO Dclk1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of DCLK1 mRNA CTD PMID:22206623 Dclk1 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of DCLK1 mRNA CTD PMID:30723492 Dclk1 Rat 17alpha-ethynylestradiol multiple interactions ISO Dclk1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of DCLK1 mRNA CTD PMID:17942748 Dclk1 Rat 17beta-estradiol multiple interactions ISO DCLK1 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of DCLK1 mRNA CTD PMID:19619570 Dclk1 Rat 17beta-estradiol decreases expression ISO Dclk1 (Mus musculus) 6480464 Estradiol results in decreased expression of DCLK1 mRNA CTD PMID:39298647 Dclk1 Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of DCLK1 mRNA CTD PMID:32741896 Dclk1 Rat 17beta-estradiol multiple interactions ISO Dclk1 (Mus musculus) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of DCLK1 mRNA CTD PMID:19693291 Dclk1 Rat 17beta-estradiol increases expression ISO DCLK1 (Homo sapiens) 6480464 Estradiol results in increased expression of DCLK1 mRNA CTD PMID:19619570 and PMID:20106945 Dclk1 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of DCLK1 mRNA CTD PMID:32741896 Dclk1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO DCLK1 (Homo sapiens) 6480464 [Endosulfan co-treated with Tetrachlorodibenzodioxin] results in increased expression of DCLK1 mRNA and [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of DCLK1 mRNA CTD PMID:19619570 and PMID:26159488 Dclk1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of DCLK1 mRNA CTD PMID:34747641 Dclk1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Dclk1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of DCLK1 mRNA CTD PMID:18343893 and PMID:26377647 Dclk1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Dclk1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of DCLK1 mRNA CTD PMID:15328365 and PMID:23994337 Dclk1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO DCLK1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of DCLK1 mRNA CTD PMID:19619570 and PMID:20106945 Dclk1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Dclk1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of DCLK1 mRNA CTD PMID:19933214 Dclk1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Dclk1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of DCLK1 mRNA CTD PMID:17942748 Dclk1 Rat 2,3,7,8-Tetrachlorodibenzofuran affects expression ISO Dclk1 (Mus musculus) 6480464 2 more ... CTD PMID:18343893 Dclk1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO DCLK1 (Homo sapiens) 6480464 2 more ... CTD PMID:26705709 Dclk1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Dclk1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Dclk1 Rat 2-methylcholine affects expression ISO DCLK1 (Homo sapiens) 6480464 beta-methylcholine affects the expression of DCLK1 mRNA CTD PMID:21179406 Dclk1 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression ISO Dclk1 (Mus musculus) 6480464 3 more ... CTD PMID:23994337 Dclk1 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Dclk1 Rat 3-methylcholanthrene decreases expression ISO Dclk1 (Mus musculus) 6480464 Methylcholanthrene results in decreased expression of DCLK1 mRNA CTD PMID:20713471 Dclk1 Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of DCLK1 mRNA CTD PMID:30723492 Dclk1 Rat 4-hydroxyphenyl retinamide decreases expression ISO Dclk1 (Mus musculus) 6480464 Fenretinide results in decreased expression of DCLK1 mRNA CTD PMID:28973697 Dclk1 Rat 5-aza-2'-deoxycytidine affects expression ISO DCLK1 (Homo sapiens) 6480464 Decitabine affects the expression of DCLK1 mRNA CTD PMID:17145863 Dclk1 Rat 5-fluorouracil multiple interactions ISO DCLK1 (Homo sapiens) 6480464 TP53 protein affects the reaction [Fluorouracil results in decreased expression of DCLK1 mRNA] CTD PMID:15016801 Dclk1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of DCLK1 mRNA CTD PMID:24780913 Dclk1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of DCLK1 mRNA CTD PMID:30047161 Dclk1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of DCLK1 mRNA CTD PMID:31881176 Dclk1 Rat aflatoxin B1 affects expression ISO DCLK1 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of DCLK1 protein CTD PMID:20106945 Dclk1 Rat aflatoxin B1 decreases methylation ISO DCLK1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of DCLK1 gene CTD PMID:27153756 Dclk1 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of DCLK1 mRNA CTD PMID:23630614 and PMID:25378103 Dclk1 Rat aflatoxin B1 decreases expression ISO DCLK1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of DCLK1 mRNA CTD PMID:22100608 Dclk1 Rat Aflatoxin B2 alpha decreases methylation ISO DCLK1 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of DCLK1 intron CTD PMID:30157460 Dclk1 Rat aldehydo-D-glucose multiple interactions ISO Dclk1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of DCLK1 mRNA CTD PMID:37567420 Dclk1 Rat allopurinol increases expression EXP 6480464 Allopurinol results in increased expression of DCLK1 mRNA CTD PMID:37876353 Dclk1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of DCLK1 mRNA CTD PMID:35163327 Dclk1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of DCLK1 mRNA CTD PMID:30047161 Dclk1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of DCLK1 mRNA CTD PMID:16483693 Dclk1 Rat amosite asbestos decreases methylation ISO DCLK1 (Homo sapiens) 6480464 Asbestos and Amosite results in decreased methylation of DCLK1 promoter CTD PMID:29626692 Dclk1 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of DCLK1 mRNA CTD PMID:30779732 Dclk1 Rat amphotericin B decreases expression ISO DCLK1 (Homo sapiens) 6480464 Amphotericin B analog results in decreased expression of DCLK1 mRNA CTD PMID:28534445 Dclk1 Rat antirheumatic drug increases expression ISO DCLK1 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of DCLK1 mRNA CTD PMID:24449571 Dclk1 Rat arsenous acid decreases expression ISO DCLK1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of DCLK1 mRNA CTD PMID:29633893 Dclk1 Rat benzo[a]pyrene decreases expression ISO DCLK1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of DCLK1 mRNA CTD PMID:20106945 Dclk1 Rat benzo[a]pyrene affects methylation ISO DCLK1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of DCLK1 intron CTD PMID:30157460 Dclk1 Rat benzo[a]pyrene increases methylation ISO DCLK1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of DCLK1 5' UTR CTD PMID:27901495 Dclk1 Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of DCLK1 mRNA CTD PMID:21839799 Dclk1 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of DCLK1 mRNA CTD PMID:18164116 Dclk1 Rat beta-naphthoflavone increases expression ISO Dclk1 (Mus musculus) 6480464 beta-Naphthoflavone results in increased expression of DCLK1 mRNA CTD PMID:23994337 Dclk1 Rat bis(2-ethylhexyl) phthalate increases expression ISO DCLK1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of DCLK1 protein CTD PMID:31163220 Dclk1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of DCLK1 mRNA CTD PMID:25181051 Dclk1 Rat bisphenol A increases expression ISO Dclk1 (Mus musculus) 6480464 bisphenol A results in increased expression of DCLK1 mRNA CTD PMID:30245210 and PMID:38701888 Dclk1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of DCLK1 mRNA CTD PMID:30816183 and PMID:34947998 Dclk1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of DCLK1 gene CTD PMID:28505145 Dclk1 Rat bisphenol A increases expression ISO DCLK1 (Homo sapiens) 6480464 bisphenol A results in increased expression of DCLK1 mRNA CTD PMID:27685785 Dclk1 Rat bosentan affects expression ISO DCLK1 (Homo sapiens) 6480464 Bosentan affects the expression of DCLK1 mRNA CTD PMID:29761207 Dclk1 Rat butanal increases expression ISO DCLK1 (Homo sapiens) 6480464 butyraldehyde results in increased expression of DCLK1 mRNA CTD PMID:26079696 Dclk1 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of DCLK1 mRNA CTD PMID:19167457 Dclk1 Rat carbon nanotube increases expression ISO Dclk1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Dclk1 Rat CGP 52608 multiple interactions ISO DCLK1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to DCLK1 gene] CTD PMID:28238834 Dclk1 Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of DCLK1 protein CTD PMID:34058248 Dclk1 Rat choline multiple interactions ISO Dclk1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of DCLK1 mRNA CTD PMID:20938992 Dclk1 Rat clotrimazole decreases expression EXP 6480464 Clotrimazole results in decreased expression of DCLK1 mRNA CTD PMID:30047161 Dclk1 Rat clozapine increases expression ISO Dclk1 (Mus musculus) 6480464 Clozapine results in increased expression of DCLK1 mRNA CTD PMID:18797397 Dclk1 Rat clozapine increases expression EXP 6480464 Clozapine results in increased expression of DCLK1 mRNA CTD PMID:15860345 Dclk1 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of DCLK1 mRNA CTD PMID:30556269 Dclk1 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of DCLK1 mRNA CTD PMID:30556269 Dclk1 Rat coumestrol decreases expression ISO DCLK1 (Homo sapiens) 6480464 Coumestrol results in decreased expression of DCLK1 mRNA CTD PMID:19167446 Dclk1 Rat coumestrol multiple interactions ISO DCLK1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:19167446 Dclk1 Rat crocidolite asbestos decreases expression ISO DCLK1 (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased expression of DCLK1 mRNA CTD PMID:25351596 Dclk1 Rat crocidolite asbestos decreases methylation ISO DCLK1 (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased methylation of DCLK1 promoter CTD PMID:29626692 Dclk1 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of DCLK1 mRNA CTD PMID:27523638 Dclk1 Rat cyclosporin A increases expression ISO DCLK1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of DCLK1 mRNA CTD PMID:20106945 Dclk1 Rat D-glucose multiple interactions ISO Dclk1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of DCLK1 mRNA CTD PMID:37567420 Dclk1 Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of DCLK1 mRNA CTD PMID:23914054 Dclk1 Rat dexamethasone increases expression ISO DCLK1 (Homo sapiens) 6480464 Dexamethasone results in increased expression of DCLK1 mRNA CTD PMID:25047013 Dclk1 Rat diarsenic trioxide decreases expression ISO DCLK1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of DCLK1 mRNA CTD PMID:29633893 Dclk1 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of DCLK1 mRNA CTD PMID:21266533 Dclk1 Rat dioxygen multiple interactions ISO Dclk1 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of DCLK1 mRNA CTD PMID:30529165 Dclk1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of DCLK1 mRNA CTD PMID:25152437 Dclk1 Rat dorsomorphin multiple interactions ISO DCLK1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Dclk1 Rat doxorubicin decreases expression ISO DCLK1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of DCLK1 mRNA CTD PMID:29803840 Dclk1 Rat doxorubicin increases expression ISO DCLK1 (Homo sapiens) 6480464 Doxorubicin results in increased expression of DCLK1 mRNA CTD PMID:30031762 Dclk1 Rat endosulfan multiple interactions ISO DCLK1 (Homo sapiens) 6480464 [Endosulfan co-treated with Tetrachlorodibenzodioxin] results in increased expression of DCLK1 mRNA CTD PMID:26159488 Dclk1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of DCLK1 mRNA CTD PMID:29391264 Dclk1 Rat Enterolactone multiple interactions ISO DCLK1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of DCLK1 mRNA CTD PMID:19167446 Dclk1 Rat entinostat multiple interactions ISO DCLK1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of DCLK1 mRNA CTD PMID:27188386 Dclk1 Rat entinostat decreases expression ISO DCLK1 (Homo sapiens) 6480464 entinostat results in decreased expression of DCLK1 mRNA CTD PMID:27188386 Dclk1 Rat entinostat increases expression ISO DCLK1 (Homo sapiens) 6480464 entinostat results in increased expression of DCLK1 mRNA CTD PMID:26272509 Dclk1 Rat ethanol multiple interactions ISO Dclk1 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of DCLK1 mRNA CTD PMID:30319688 Dclk1 Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of DCLK1 mRNA CTD PMID:18035473 Dclk1 Rat fluoxetine increases expression EXP 6480464 Fluoxetine results in increased expression of DCLK1 mRNA CTD PMID:18301726 Dclk1 Rat folic acid multiple interactions ISO Dclk1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of DCLK1 mRNA CTD PMID:20938992 Dclk1 Rat folic acid decreases expression ISO Dclk1 (Mus musculus) 6480464 Folic Acid results in decreased expression of DCLK1 mRNA CTD PMID:25629700 Dclk1 Rat formaldehyde decreases expression ISO DCLK1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of DCLK1 mRNA CTD PMID:28937961 Dclk1 Rat FR900359 affects phosphorylation ISO DCLK1 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of DCLK1 protein CTD PMID:37730182 Dclk1 Rat fructose multiple interactions ISO Dclk1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of DCLK1 mRNA CTD PMID:37567420 Dclk1 Rat furan increases expression EXP 6480464 furan results in increased expression of DCLK1 mRNA CTD PMID:27387713 Dclk1 Rat genistein increases expression ISO Dclk1 (Mus musculus) 6480464 Genistein results in increased expression of DCLK1 mRNA CTD PMID:32186404 Dclk1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of DCLK1 mRNA CTD PMID:33387578 Dclk1 Rat glucose multiple interactions ISO Dclk1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of DCLK1 mRNA CTD PMID:37567420 Dclk1 Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of DCLK1 mRNA CTD PMID:33150645 Dclk1 Rat glycidol increases methylation EXP 6480464 glycidol results in increased methylation of DCLK1 promoter CTD PMID:33150595 Dclk1 Rat haloperidol increases expression ISO Dclk1 (Mus musculus) 6480464 Haloperidol results in increased expression of DCLK1 mRNA CTD PMID:18797397 Dclk1 Rat haloperidol increases expression EXP 6480464 Haloperidol results in increased expression of DCLK1 mRNA CTD PMID:15860345 Dclk1 Rat ivermectin decreases expression ISO DCLK1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of DCLK1 protein CTD PMID:32959892 Dclk1 Rat L-ascorbic acid increases expression ISO Dclk1 (Mus musculus) 6480464 Ascorbic Acid results in increased expression of DCLK1 mRNA CTD PMID:15305145 Dclk1 Rat L-methionine multiple interactions ISO Dclk1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of DCLK1 mRNA CTD PMID:20938992 Dclk1 Rat lead(0) affects expression ISO DCLK1 (Homo sapiens) 6480464 Lead affects the expression of DCLK1 mRNA CTD PMID:28903495 Dclk1 Rat methylmercury chloride increases expression ISO DCLK1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of DCLK1 mRNA CTD PMID:23179753 and PMID:26272509 Dclk1 Rat methylmercury chloride decreases expression ISO DCLK1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of DCLK1 mRNA CTD PMID:28001369 Dclk1 Rat methylmercury chloride multiple interactions ISO DCLK1 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of DCLK1 mRNA CTD PMID:27188386 Dclk1 Rat Muraglitazar decreases expression EXP 6480464 muraglitazar results in decreased expression of DCLK1 mRNA CTD PMID:21515302 Dclk1 Rat N-methyl-4-phenylpyridinium decreases expression ISO DCLK1 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of DCLK1 mRNA CTD PMID:24810058 Dclk1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of DCLK1 mRNA CTD PMID:18164116 Dclk1 Rat nickel atom decreases expression ISO DCLK1 (Homo sapiens) 6480464 Nickel results in decreased expression of DCLK1 mRNA CTD PMID:24768652 Dclk1 Rat olanzapine increases expression ISO Dclk1 (Mus musculus) 6480464 olanzapine results in increased expression of DCLK1 mRNA CTD PMID:18797397 Dclk1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of DCLK1 mRNA CTD PMID:25729387 Dclk1 Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of DCLK1 mRNA CTD PMID:25729387 Dclk1 Rat panobinostat multiple interactions ISO DCLK1 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of DCLK1 mRNA CTD PMID:27188386 Dclk1 Rat panobinostat increases expression ISO DCLK1 (Homo sapiens) 6480464 panobinostat results in increased expression of DCLK1 mRNA CTD PMID:26272509 Dclk1 Rat paracetamol increases expression ISO DCLK1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of DCLK1 mRNA CTD PMID:29067470 Dclk1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of DCLK1 mRNA CTD PMID:33387578 Dclk1 Rat pentanal increases expression ISO DCLK1 (Homo sapiens) 6480464 pentanal results in increased expression of DCLK1 mRNA CTD PMID:26079696 Dclk1 Rat perfluorononanoic acid increases expression ISO DCLK1 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in increased expression of DCLK1 mRNA CTD PMID:32588087 Dclk1 Rat perfluorooctane-1-sulfonic acid increases expression ISO DCLK1 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in increased expression of DCLK1 mRNA CTD PMID:32588087 Dclk1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of DCLK1 mRNA CTD PMID:35163327 Dclk1 Rat perfluorooctanoic acid increases expression ISO DCLK1 (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of DCLK1 mRNA CTD PMID:32588087 Dclk1 Rat pirinixic acid increases expression ISO Dclk1 (Mus musculus) 6480464 pirinixic acid results in increased expression of DCLK1 mRNA CTD PMID:20813756 Dclk1 Rat potassium dichromate decreases expression ISO Dclk1 (Mus musculus) 6480464 Potassium Dichromate results in decreased expression of DCLK1 mRNA CTD PMID:23608068 Dclk1 Rat progesterone multiple interactions ISO Dclk1 (Mus musculus) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of DCLK1 mRNA CTD PMID:19693291 Dclk1 Rat propanal increases expression ISO DCLK1 (Homo sapiens) 6480464 propionaldehyde results in increased expression of DCLK1 mRNA CTD PMID:26079696 Dclk1 Rat resveratrol multiple interactions ISO DCLK1 (Homo sapiens) 6480464 [Coumestrol co-treated with Resveratrol] results in decreased expression of DCLK1 mRNA and [Plant Extracts co-treated with Resveratrol] results in decreased expression of DCLK1 mRNA CTD PMID:19167446 and PMID:23557933 Dclk1 Rat resveratrol increases expression ISO Dclk1 (Mus musculus) 6480464 resveratrol results in increased expression of DCLK1 protein CTD PMID:25505154 Dclk1 Rat SB 431542 multiple interactions ISO DCLK1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Dclk1 Rat serpentine asbestos decreases methylation ISO DCLK1 (Homo sapiens) 6480464 Asbestos and Serpentine results in decreased methylation of DCLK1 promoter CTD PMID:29626692 Dclk1 Rat silicon dioxide increases expression ISO DCLK1 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of DCLK1 mRNA CTD PMID:25895662 Dclk1 Rat silicon dioxide increases expression ISO Dclk1 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of DCLK1 mRNA CTD PMID:29341224 Dclk1 Rat sodium arsenite increases expression ISO DCLK1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of DCLK1 mRNA CTD PMID:29301061 Dclk1 Rat sodium arsenite affects expression ISO Dclk1 (Mus musculus) 6480464 sodium arsenite affects the expression of DCLK1 mRNA CTD PMID:26674514 Dclk1 Rat sodium arsenite decreases expression ISO DCLK1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of DCLK1 mRNA CTD PMID:34032870 Dclk1 Rat Soman increases expression EXP 6480464 Soman results in increased expression of DCLK1 mRNA CTD PMID:19281266 Dclk1 Rat Tesaglitazar decreases expression EXP 6480464 tesaglitazar results in decreased expression of DCLK1 mRNA CTD PMID:21515302 Dclk1 Rat testosterone decreases expression ISO Dclk1 (Mus musculus) 6480464 Testosterone results in decreased expression of DCLK1 mRNA CTD PMID:19693291 Dclk1 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of DCLK1 mRNA CTD PMID:32741896 Dclk1 Rat tetrachloromethane increases expression ISO Dclk1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of DCLK1 mRNA CTD PMID:17484886 Dclk1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of DCLK1 mRNA CTD PMID:34492290 Dclk1 Rat titanium dioxide increases expression ISO Dclk1 (Mus musculus) 6480464 titanium dioxide results in increased expression of DCLK1 mRNA CTD PMID:23557971 Dclk1 Rat titanium dioxide decreases methylation ISO Dclk1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of DCLK1 gene CTD PMID:35295148 Dclk1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of DCLK1 mRNA CTD PMID:25729387 Dclk1 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of DCLK1 mRNA CTD PMID:25729387 Dclk1 Rat tributylstannane increases expression ISO Dclk1 (Mus musculus) 6480464 tributyltin results in increased expression of DCLK1 mRNA CTD PMID:31939706 Dclk1 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of DCLK1 gene CTD PMID:27618143 Dclk1 Rat trichostatin A decreases expression ISO DCLK1 (Homo sapiens) 6480464 trichostatin A results in decreased expression of DCLK1 mRNA CTD PMID:24935251 Dclk1 Rat trichostatin A increases expression ISO DCLK1 (Homo sapiens) 6480464 trichostatin A results in increased expression of DCLK1 mRNA CTD PMID:24935251 Dclk1 Rat trimellitic anhydride decreases expression ISO Dclk1 (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of DCLK1 mRNA CTD PMID:19042947 Dclk1 Rat triptonide increases expression ISO Dclk1 (Mus musculus) 6480464 triptonide results in increased expression of DCLK1 mRNA CTD PMID:33045310 Dclk1 Rat troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of DCLK1 mRNA CTD PMID:21515302 Dclk1 Rat urethane decreases expression ISO DCLK1 (Homo sapiens) 6480464 Urethane results in decreased expression of DCLK1 mRNA CTD PMID:28818685 Dclk1 Rat valproic acid increases methylation ISO DCLK1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of DCLK1 gene CTD PMID:29154799 Dclk1 Rat valproic acid decreases expression ISO DCLK1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of DCLK1 mRNA CTD PMID:27188386 Dclk1 Rat valproic acid multiple interactions ISO DCLK1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of DCLK1 mRNA CTD PMID:27188386 Dclk1 Rat valproic acid increases expression ISO DCLK1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of DCLK1 mRNA CTD PMID:23179753 more ... Dclk1 Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of DCLK1 mRNA CTD PMID:29427782 Dclk1 Rat vorinostat decreases expression ISO DCLK1 (Homo sapiens) 6480464 vorinostat results in decreased expression of DCLK1 mRNA CTD PMID:27188386 Dclk1 Rat zinc atom multiple interactions ISO DCLK1 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of DCLK1 mRNA CTD PMID:18593933 Dclk1 Rat zinc(0) multiple interactions ISO DCLK1 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of DCLK1 mRNA CTD PMID:18593933
1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-methylcholine (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP,ISO) 3-methylcholanthrene (ISO) 4,4'-diaminodiphenylmethane (EXP) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aflatoxin B1 (EXP,ISO) Aflatoxin B2 alpha (ISO) aldehydo-D-glucose (ISO) allopurinol (EXP) alpha-Zearalanol (EXP) amitrole (EXP) ammonium chloride (EXP) amosite asbestos (ISO) amphetamine (EXP) amphotericin B (ISO) antirheumatic drug (ISO) arsenous acid (ISO) benzo[a]pyrene (EXP,ISO) beta-naphthoflavone (EXP,ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bosentan (ISO) butanal (ISO) C60 fullerene (EXP) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (EXP) choline (ISO) clotrimazole (EXP) clozapine (EXP,ISO) copper atom (EXP) copper(0) (EXP) coumestrol (ISO) crocidolite asbestos (ISO) Cuprizon (EXP) cyclosporin A (ISO) D-glucose (ISO) decabromodiphenyl ether (EXP) dexamethasone (ISO) diarsenic trioxide (ISO) dibutyl phthalate (EXP) dioxygen (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP,ISO) Enterolactone (ISO) entinostat (ISO) ethanol (ISO) flavonoids (EXP) fluoxetine (EXP) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) fructose (ISO) furan (EXP) genistein (ISO) gentamycin (EXP) glucose (ISO) glycidol (EXP) haloperidol (EXP,ISO) ivermectin (ISO) L-ascorbic acid (ISO) L-methionine (ISO) lead(0) (ISO) methylmercury chloride (ISO) Muraglitazar (EXP) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP) nickel atom (ISO) olanzapine (ISO) oxaliplatin (EXP) panobinostat (ISO) paracetamol (EXP,ISO) pentanal (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP,ISO) pirinixic acid (ISO) potassium dichromate (ISO) progesterone (ISO) propanal (ISO) resveratrol (ISO) SB 431542 (ISO) serpentine asbestos (ISO) silicon dioxide (ISO) sodium arsenite (ISO) Soman (EXP) Tesaglitazar (EXP) testosterone (EXP,ISO) tetrachloromethane (ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) tributylstannane (ISO) trichloroethene (EXP) trichostatin A (ISO) trimellitic anhydride (ISO) triptonide (ISO) troglitazone (EXP) urethane (ISO) valproic acid (EXP,ISO) vorinostat (ISO) zinc atom (ISO) zinc(0) (ISO)
1.
A complex program of striatal gene expression induced by dopaminergic stimulation.
Berke JD, etal., J Neurosci 1998 Jul 15;18(14):5301-10.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Hippocampal plasticity involves extensive gene induction and multiple cellular mechanisms.
Hevroni D, etal., J Mol Neurosci 1998 Apr;10(2):75-98.
5.
A novel role for doublecortin and doublecortin-like kinase in regulating growth cone microtubules.
Jean DC, etal., Hum Mol Genet. 2012 Dec 15;21(26):5511-27. doi: 10.1093/hmg/dds395. Epub 2012 Sep 21.
6.
DCAMKL1 encodes a protein kinase with homology to doublecortin that regulates microtubule polymerization.
Lin PT, etal., J Neurosci 2000 Dec 15;20(24):9152-61.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
GOA pipeline
RGD automated data pipeline
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Catalytic and regulatory domains of doublecortin kinase-1.
Shang L, etal., Biochemistry 2003 Feb 25;42(7):2185-94.
13.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
14.
Kainate-elicited seizures induce mRNA encoding a CaMK-related peptide: a putative modulator of kinase activity in rat hippocampus.
Vreugdenhil E, etal., J Neurobiol 1999 Apr;39(1):41-50.
Dclk1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 141,567,215 - 141,861,088 (+) NCBI GRCr8 mRatBN7.2 2 139,417,234 - 139,710,956 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 139,417,163 - 139,710,956 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 146,207,364 - 146,283,054 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 144,318,813 - 144,394,500 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 138,951,229 - 139,026,915 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 144,646,255 - 144,939,389 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 144,646,308 - 144,936,927 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 164,062,498 - 164,355,201 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 144,678,222 - 144,754,237 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 144,628,184 - 144,704,200 (+) NCBI Celera 2 134,114,211 - 134,191,878 (+) NCBI Celera Cytogenetic Map 2 q26 NCBI
DCLK1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 13 35,768,652 - 36,131,939 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 13 35,768,652 - 36,131,382 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 13 36,342,789 - 36,706,076 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 13 35,243,478 - 35,603,443 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 13 35,243,477 - 35,603,443 NCBI Celera 13 17,410,025 - 17,772,331 (-) NCBI Celera Cytogenetic Map 13 q13.3 NCBI HuRef 13 17,497,886 - 17,517,445 (-) NCBI HuRef HuRef 13 17,156,100 - 17,334,637 (-) NCBI HuRef CHM1_1 13 36,310,364 - 36,673,089 (-) NCBI CHM1_1 T2T-CHM13v2.0 13 34,986,929 - 35,351,445 (-) NCBI T2T-CHM13v2.0
Dclk1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 55,149,724 - 55,446,489 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 55,149,785 - 55,446,489 (+) Ensembl GRCm39 Ensembl GRCm38 3 55,242,303 - 55,539,068 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 55,242,364 - 55,539,068 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 55,046,448 - 55,342,990 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 55,330,557 - 55,624,607 (+) NCBI MGSCv36 mm8 Celera 3 54,960,357 - 55,257,519 (+) NCBI Celera Cytogenetic Map 3 C NCBI cM Map 3 26.53 NCBI
Dclk1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955431 9,975,262 - 10,297,010 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955431 9,975,629 - 10,302,605 (+) NCBI ChiLan1.0 ChiLan1.0
DCLK1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 14 35,300,686 - 35,655,551 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 13 26,406,603 - 26,761,388 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 13 16,988,340 - 17,342,911 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 13 35,419,835 - 35,768,949 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 13 35,425,382 - 35,768,935 (-) Ensembl panpan1.1 panPan2
DCLK1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 25 4,441,945 - 4,783,542 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 25 4,345,771 - 4,778,047 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 25 4,474,081 - 4,820,850 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 25 4,543,814 - 4,885,237 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 25 4,544,126 - 4,880,032 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 25 4,450,895 - 4,791,838 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 25 4,446,133 - 4,787,610 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 25 4,510,453 - 4,851,667 (+) NCBI UU_Cfam_GSD_1.0
Dclk1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 165,664,364 - 165,993,443 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936472 29,964,218 - 30,287,841 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936472 29,958,716 - 30,287,798 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DCLK1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 11 11,815,357 - 12,158,826 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 11 11,815,258 - 12,159,085 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 11 11,847,739 - 12,121,589 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DCLK1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 3 14,358,997 - 14,713,621 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 3 14,362,301 - 14,536,027 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666057 29,580,519 - 29,932,214 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Dclk1
.
Predicted Target Of
Count of predictions: 2037 Count of miRNA genes: 380 Interacting mature miRNAs: 585 Transcripts: ENSRNOT00000019748, ENSRNOT00000072110 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 2293671 Bss44 Bone structure and strength QTL 44 10.97 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 2 43162366 148478373 Rat 1549841 Bp256 Blood pressure QTL 256 0.03 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 137219876 142323610 Rat 631566 Bp90 Blood pressure QTL 90 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 102803808 147803808 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 6907363 Bp357 Blood pressure QTL 357 4.1 0.002 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 129540907 174540907 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1358360 Sradr2 Stress Responsive Adrenal Weight QTL 2 10.24 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 2 129164097 152195315 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 1298076 Bp166 Blood pressure QTL 166 0.0009 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 136445150 202447032 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 1581578 Cm49 Cardiac mass QTL 49 4.9 0.01 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 127447387 143657569 Rat 12879830 Bw178 Body weight QTL 178 0.001 body mass (VT:0001259) body weight (CMO:0000012) 2 137219876 142323610 Rat 12879831 Cm82 Cardiac mass QTL 82 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 2 137219876 142323610 Rat 631198 Cm22 Cardiac mass QTL 22 4.3 0.0008 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 76539322 150540526 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 1302794 Stl27 Serum triglyceride level QTL 27 4.4 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 25413423 143657569 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 12879832 Cm83 Cardiac mass QTL 83 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 137219876 142323610 Rat 12879833 Cm84 Cardiac mass QTL 84 0.001 heart right ventricle mass (VT:0007033) heart weight to body weight ratio (CMO:0000074) 2 137219876 142323610 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 135552573 202446871 Rat 12879834 Am1 Aortic mass QTL 1 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 2 137219876 142323610 Rat 12879835 Kidm60 Kidney mass QTL 60 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 137219876 142323610 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1359030 Bp277 Blood pressure QTL 277 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 114837527 185876470 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 1581502 Esta3 Estrogen-induced thymic atrophy QTL 3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 136916935 189599348 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1582257 Gluco21 Glucose level QTL 21 3.1 0.0035 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 118111229 157142209 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1359035 Bp276 Blood pressure QTL 276 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 114837527 143657569 Rat 8662836 Vetf8 Vascular elastic tissue fragility QTL 8 0.66 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 104559726 149559726 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 5135226 Leukc2 Leukocyte quantity QTL 2 eosinophil quantity (VT:0002602) blood eosinophil count (CMO:0000033) 2 118111229 149559726 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 2299162 Iddm32 Insulin dependent diabetes mellitus QTL 32 2.36 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 78665616 143657569 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 7488931 Bp367 Blood pressure QTL 367 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 139401804 142323610 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300165 Rf9 Renal function QTL 9 3.28 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 2 133914684 202447032 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 738007 Anxrr7 Anxiety related response QTL 7 4.4 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 118189491 163189491 Rat 2293835 Kiddil5 Kidney dilation QTL 5 3.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 157142209 Rat 1581552 Pur12 Proteinuria QTL 12 5.19 0.0009 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 2 112103657 148076632 Rat 1558653 Prcr1 Prostate cancer resistance QTL 1 5 prostate integrity trait (VT:0010571) area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899) 2 72532993 157142209 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 1354594 Despr10 Despair related QTL 10 2e-06 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 2 114654253 159654253 Rat 152025206 Hrtrt23 Heart rate QTL 23 5.98 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 152025204 Hrtrt22 Heart rate QTL 22 5.6 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat 61438 Cia7 Collagen induced arthritis QTL 7 4.6 0.0001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 2 59324377 141596857 Rat
AA963194
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 139,638,475 - 139,638,694 (+) MAPPER mRatBN7.2 Rnor_6.0 2 144,867,175 - 144,867,393 NCBI Rnor6.0 Rnor_5.0 2 164,283,008 - 164,283,226 UniSTS Rnor5.0 RGSC_v3.4 2 144,683,942 - 144,684,160 UniSTS RGSC3.4 Celera 2 134,119,937 - 134,120,155 UniSTS RH 3.4 Map 2 861.4 UniSTS Cytogenetic Map 2 q26 UniSTS
RH139488
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 139,710,646 - 139,710,851 (+) MAPPER mRatBN7.2 Rnor_6.0 2 144,939,080 - 144,939,284 NCBI Rnor6.0 Rnor_5.0 2 164,354,892 - 164,355,096 UniSTS Rnor5.0 RGSC_v3.4 2 144,756,390 - 144,756,594 UniSTS RGSC3.4 Celera 2 134,191,569 - 134,191,773 UniSTS RH 3.4 Map 2 861.5 UniSTS RH 3.4 Map 2 861.4 UniSTS Cytogenetic Map 2 q26 UniSTS
BF387208
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 139,656,970 - 139,657,138 (+) MAPPER mRatBN7.2 Rnor_6.0 2 144,885,440 - 144,885,607 NCBI Rnor6.0 Rnor_5.0 2 164,301,252 - 164,301,419 UniSTS Rnor5.0 RGSC_v3.4 2 144,702,544 - 144,702,711 UniSTS RGSC3.4 Celera 2 134,137,859 - 134,138,026 UniSTS RH 3.4 Map 2 861.5 UniSTS Cytogenetic Map 2 q26 UniSTS
BE106390
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 139,700,456 - 139,700,618 (+) MAPPER mRatBN7.2 Rnor_6.0 2 144,928,890 - 144,929,051 NCBI Rnor6.0 Rnor_5.0 2 164,344,702 - 164,344,863 UniSTS Rnor5.0 RGSC_v3.4 2 144,746,200 - 144,746,361 UniSTS RGSC3.4 Celera 2 134,181,379 - 134,181,540 UniSTS RH 3.4 Map 2 861.4 UniSTS Cytogenetic Map 2 q26 UniSTS
AI836758
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 139,710,570 - 139,710,712 (+) MAPPER mRatBN7.2 Rnor_6.0 2 144,939,004 - 144,939,145 NCBI Rnor6.0 Rnor_5.0 2 164,354,816 - 164,354,957 UniSTS Rnor5.0 RGSC_v3.4 2 144,756,314 - 144,756,455 UniSTS RGSC3.4 Celera 2 134,191,493 - 134,191,634 UniSTS Cytogenetic Map 2 q26 UniSTS
RH137977
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 139,695,387 - 139,695,572 (+) MAPPER mRatBN7.2 Rnor_6.0 2 144,923,821 - 144,924,005 NCBI Rnor6.0 Rnor_5.0 2 164,339,633 - 164,339,817 UniSTS Rnor5.0 RGSC_v3.4 2 144,741,131 - 144,741,315 UniSTS RGSC3.4 Celera 2 134,176,310 - 134,176,494 UniSTS RH 3.4 Map 2 861.5 UniSTS Cytogenetic Map 2 q26 UniSTS
RH138275
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 139,672,956 - 139,673,108 (+) MAPPER mRatBN7.2 Rnor_6.0 2 144,901,393 - 144,901,544 NCBI Rnor6.0 Rnor_5.0 2 164,317,205 - 164,317,356 UniSTS Rnor5.0 RGSC_v3.4 2 144,718,702 - 144,718,853 UniSTS RGSC3.4 Celera 2 134,153,832 - 134,153,983 UniSTS RH 3.4 Map 2 860.3 UniSTS Cytogenetic Map 2 q26 UniSTS
RH140320
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 139,710,677 - 139,710,852 (+) MAPPER mRatBN7.2 Rnor_6.0 2 144,939,111 - 144,939,285 NCBI Rnor6.0 Rnor_5.0 2 164,354,923 - 164,355,097 UniSTS Rnor5.0 RGSC_v3.4 2 144,756,421 - 144,756,595 UniSTS RGSC3.4 Celera 2 134,191,600 - 134,191,774 UniSTS Cytogenetic Map 2 q26 UniSTS
RH141428
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 139,638,085 - 139,638,299 (+) MAPPER mRatBN7.2 Rnor_6.0 2 144,866,785 - 144,866,998 NCBI Rnor6.0 Rnor_5.0 2 164,282,618 - 164,282,831 UniSTS Rnor5.0 RGSC_v3.4 2 144,683,552 - 144,683,765 UniSTS RGSC3.4 Celera 2 134,119,547 - 134,119,760 UniSTS RH 3.4 Map 2 862.2 UniSTS Cytogenetic Map 2 q26 UniSTS
ha2752
Rat Assembly Chr Position (strand) Source JBrowse Celera 2 134,147,669 - 134,148,365 UniSTS Cytogenetic Map 2 q26 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
87
86
55
25
55
6
214
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000019748 ⟹ ENSRNOP00000019748
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 139,632,744 - 139,710,956 (+) Ensembl Rnor_6.0 Ensembl 2 144,861,455 - 144,936,927 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000072110 ⟹ ENSRNOP00000067781
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 139,417,163 - 139,641,880 (+) Ensembl Rnor_6.0 Ensembl 2 144,861,459 - 144,870,582 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000078337 ⟹ ENSRNOP00000075702
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 139,417,423 - 139,647,677 (+) Ensembl Rnor_6.0 Ensembl 2 144,646,308 - 144,934,025 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000093284 ⟹ ENSRNOP00000076110
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 139,649,914 - 139,710,956 (+) Ensembl Rnor_6.0 Ensembl 2 144,861,455 - 144,936,807 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000093407 ⟹ ENSRNOP00000076341
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 139,417,163 - 139,708,357 (+) Ensembl Rnor_6.0 Ensembl 2 144,646,429 - 144,936,803 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000099182 ⟹ ENSRNOP00000090378
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 139,417,163 - 139,710,956 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000107822 ⟹ ENSRNOP00000083313
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 139,417,163 - 139,710,956 (+) Ensembl
RefSeq Acc Id:
NM_021584 ⟹ NP_067595
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 141,782,884 - 141,792,022 (+) NCBI mRatBN7.2 2 139,632,744 - 139,641,884 (+) NCBI Rnor_6.0 2 144,861,445 - 144,870,583 (+) NCBI Rnor_5.0 2 164,062,498 - 164,355,201 (+) NCBI Celera 2 134,114,211 - 134,123,345 (+) NCBI
Sequence:
CCTGCATCTCATTCAGCCCGCTCCCCGAGCAGCCTTAGCCATCCCTAACTAATCCAACTGCTTCCCAGTCTGCGGGTGCTGGGCTCGGTGCTGAGAAGAGGCTCTGGCTCTTGGCTATTGTCAGGTCA
hide sequence
RefSeq Acc Id:
NM_053343 ⟹ NP_445795
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 141,782,884 - 141,861,088 (+) NCBI mRatBN7.2 2 139,632,744 - 139,710,956 (+) NCBI Rnor_6.0 2 144,861,445 - 144,939,389 (+) NCBI Rnor_5.0 2 164,062,498 - 164,355,201 (+) NCBI RGSC_v3.4 2 144,678,222 - 144,754,237 (+) RGD Celera 2 134,114,211 - 134,191,878 (+) NCBI
Sequence:
CCTGCATCTCATTCAGCCCGCTCCCCGAGCAGCCTTAGCCATCCCTAACTAATCCAACTGCTTCCCAGTCTGCGGGTGCTGGGCTCGGTGCTGAGAAGAGGCTCTGGCTCTTGGCTATTGTCAGGTCA
hide sequence
RefSeq Acc Id:
XM_008761005 ⟹ XP_008759227
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 141,782,691 - 141,858,627 (+) NCBI mRatBN7.2 2 139,632,574 - 139,710,956 (+) NCBI Rnor_6.0 2 144,860,554 - 144,933,928 (+) NCBI
Sequence:
GTTAATTTAATCCCCAGCCAACCACTAGGGGCAGCAACTCTTCCCTTGGTAGGCGTGGATTCCAACCACTAGGGGCAGCAACTCTTCCCTTGGTAGGCGTGGATTCCAACCACTAGGGGCAGCAACTC
hide sequence
RefSeq Acc Id:
XM_017591138 ⟹ XP_017446627
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 141,782,691 - 141,858,627 (+) NCBI mRatBN7.2 2 139,632,572 - 139,710,956 (+) NCBI Rnor_6.0 2 144,860,553 - 144,939,389 (+) NCBI
Sequence:
TGTTAATTTAATCCCCAGCCAACCACTAGGGGCAGCAACTCTTCCCTTGGTAGGCGTGGATTCCAACCACTAGGGGCAGCAACTCTTCCCTTGGTAGGCGTGGATTCCAACCACTAGGGGCAGCAACT
hide sequence
RefSeq Acc Id:
XM_017591139 ⟹ XP_017446628
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 141,567,215 - 141,858,627 (+) NCBI mRatBN7.2 2 139,417,245 - 139,710,956 (+) NCBI Rnor_6.0 2 144,646,255 - 144,933,928 (+) NCBI
Sequence:
ATCACCAAGATCATTGCAGCCAGAAGCCTGGCTAGAGGAGGGAGGACCCTGGACTCAGCCACGG
hide sequence
RefSeq Acc Id:
XM_039103247 ⟹ XP_038959175
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 141,567,215 - 141,858,627 (+) NCBI mRatBN7.2 2 139,417,244 - 139,710,956 (+) NCBI
RefSeq Acc Id:
XM_039103249 ⟹ XP_038959177
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 141,567,215 - 141,858,627 (+) NCBI mRatBN7.2 2 139,417,241 - 139,710,956 (+) NCBI
RefSeq Acc Id:
XM_039103250 ⟹ XP_038959178
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 141,567,215 - 141,858,627 (+) NCBI mRatBN7.2 2 139,417,247 - 139,710,956 (+) NCBI
RefSeq Acc Id:
XM_039103252 ⟹ XP_038959180
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 141,567,215 - 141,858,627 (+) NCBI mRatBN7.2 2 139,417,245 - 139,710,956 (+) NCBI
RefSeq Acc Id:
XM_039103253 ⟹ XP_038959181
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 141,567,215 - 141,858,627 (+) NCBI mRatBN7.2 2 139,417,242 - 139,710,956 (+) NCBI
RefSeq Acc Id:
XM_039103254 ⟹ XP_038959182
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 141,567,215 - 141,858,627 (+) NCBI mRatBN7.2 2 139,417,240 - 139,710,956 (+) NCBI
RefSeq Acc Id:
XM_039103255 ⟹ XP_038959183
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 141,782,691 - 141,858,627 (+) NCBI mRatBN7.2 2 139,632,574 - 139,710,956 (+) NCBI
RefSeq Acc Id:
XM_039103256 ⟹ XP_038959184
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 141,782,691 - 141,858,627 (+) NCBI mRatBN7.2 2 139,632,570 - 139,710,956 (+) NCBI
RefSeq Acc Id:
XM_039103257 ⟹ XP_038959185
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 141,567,215 - 141,792,022 (+) NCBI mRatBN7.2 2 139,417,236 - 139,641,884 (+) NCBI
RefSeq Acc Id:
XM_039103258 ⟹ XP_038959186
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 141,567,215 - 141,792,022 (+) NCBI mRatBN7.2 2 139,417,234 - 139,641,884 (+) NCBI
RefSeq Acc Id:
XM_039103260 ⟹ XP_038959188
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 141,567,215 - 141,792,022 (+) NCBI mRatBN7.2 2 139,417,234 - 139,641,884 (+) NCBI
RefSeq Acc Id:
XM_063282639 ⟹ XP_063138709
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 141,782,691 - 141,858,627 (+) NCBI
RefSeq Acc Id:
XM_063282640 ⟹ XP_063138710
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 141,782,056 - 141,792,022 (+) NCBI
RefSeq Acc Id:
NP_445795 ⟸ NM_053343
- Peptide Label:
isoform 1
- UniProtKB:
O08875 (UniProtKB/Swiss-Prot), A6JVF3 (UniProtKB/TrEMBL), A6JVF1 (UniProtKB/TrEMBL)
- Sequence:
MLELIEVNGTPGSQLSTPRSGKSPSPSPTSPGSLRKQRISQHGGSSTSLSSTKVCSSMDENDGPGEEESDEGFQIPATITERYKVGRTIGDGNFAVVKECIERSTAREYALKIIKKSKCRGKEHMIQN
hide sequence
RefSeq Acc Id:
NP_067595 ⟸ NM_021584
- Peptide Label:
isoform 2
- UniProtKB:
Q9WVP7 (UniProtKB/TrEMBL), Q9R1P9 (UniProtKB/TrEMBL)
- Sequence:
MLELIEVNGTPGSQLSTPRSGKSPSPSPTSPGSLRKQRDLYRPLSSDDLDSVGDSV
hide sequence
RefSeq Acc Id:
XP_008759227 ⟸ XM_008761005
- Peptide Label:
isoform X11
- Sequence:
MLELIEVNGTPGSQLSTPRSGKSPSPSPTSPGSLRKQRISQHGGSSTSLSSTKVCSSMDENDGPGEEESDEGFQIPATITERYKVGRTIGDGNFAVVKECIERSTAREYALKIIKKSKCRGKEHMIQN
hide sequence
RefSeq Acc Id:
XP_017446628 ⟸ XM_017591139
- Peptide Label:
isoform X5
- UniProtKB:
A0A1W2Q6Q2 (UniProtKB/TrEMBL), A0A8I6AMY9 (UniProtKB/TrEMBL)
- Sequence:
MSFGRDMELEHFDERDKAQRYSRGSRVNGLPSPTHSAHCSFYRTRTLQTLSSEKKAKKVRFYRN
hide sequence
RefSeq Acc Id:
XP_017446627 ⟸ XM_017591138
- Peptide Label:
isoform X8
- UniProtKB:
A0A8L2QB01 (UniProtKB/TrEMBL), A6JVF1 (UniProtKB/TrEMBL)
- Sequence:
MLELIEVNGTPGSQLSTPRSGKSPSPSPTSPGSLRKQRISQHGGSSTSLSSTKVCSSMDENDGP
hide sequence
Ensembl Acc Id:
ENSRNOP00000019748 ⟸ ENSRNOT00000019748
Ensembl Acc Id:
ENSRNOP00000076341 ⟸ ENSRNOT00000093407
Ensembl Acc Id:
ENSRNOP00000075702 ⟸ ENSRNOT00000078337
Ensembl Acc Id:
ENSRNOP00000076110 ⟸ ENSRNOT00000093284
Ensembl Acc Id:
ENSRNOP00000067781 ⟸ ENSRNOT00000072110
RefSeq Acc Id:
XP_038959186 ⟸ XM_039103258
- Peptide Label:
isoform X13
- UniProtKB:
M0RDS3 (UniProtKB/TrEMBL), A0A0G2KB92 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038959188 ⟸ XM_039103260
- Peptide Label:
isoform X13
- UniProtKB:
M0RDS3 (UniProtKB/TrEMBL), A0A0G2KB92 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038959185 ⟸ XM_039103257
- Peptide Label:
isoform X13
- UniProtKB:
M0RDS3 (UniProtKB/TrEMBL), A0A0G2KB92 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038959182 ⟸ XM_039103254
- Peptide Label:
isoform X7
- UniProtKB:
A0A8I6AMY9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038959177 ⟸ XM_039103249
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6AMY9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038959181 ⟸ XM_039103253
- Peptide Label:
isoform X6
- UniProtKB:
A0A8I6AMY9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038959175 ⟸ XM_039103247
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZWQ8 (UniProtKB/TrEMBL), A0A8I6AMY9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038959180 ⟸ XM_039103252
- Peptide Label:
isoform X4
- UniProtKB:
A0A8I6AMY9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038959178 ⟸ XM_039103250
- Peptide Label:
isoform X3
- UniProtKB:
A0A3Q9WS43 (UniProtKB/TrEMBL), A0A8I6AMY9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038959184 ⟸ XM_039103256
- Peptide Label:
isoform X12
RefSeq Acc Id:
XP_038959183 ⟸ XM_039103255
- Peptide Label:
isoform X10
- UniProtKB:
A6JVF1 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000090378 ⟸ ENSRNOT00000099182
Ensembl Acc Id:
ENSRNOP00000083313 ⟸ ENSRNOT00000107822
RefSeq Acc Id:
XP_063138710 ⟸ XM_063282640
- Peptide Label:
isoform X14
- UniProtKB:
Q9WVP7 (UniProtKB/TrEMBL), Q9R1P9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063138709 ⟸ XM_063282639
- Peptide Label:
isoform X9
RGD ID: 13691347 Promoter ID: EPDNEW_R1858 Type: initiation region Name: Dclk1_1 Description: doublecortin-like kinase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R1859 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 144,646,429 - 144,646,489 EPDNEW
RGD ID: 13691334 Promoter ID: EPDNEW_R1859 Type: multiple initiation site Name: Dclk1_2 Description: doublecortin-like kinase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R1858 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 144,861,450 - 144,861,510 EPDNEW
BioCyc Gene G2FUF-53062 BioCyc
Ensembl Genes ENSRNOG00000032922 Ensembl, ENTREZGENE
Ensembl Transcript ENSRNOT00000019748 ENTREZGENE
ENSRNOT00000078337 ENTREZGENE
ENSRNOT00000093407 ENTREZGENE
ENSRNOT00000099182 ENTREZGENE
ENSRNOT00000107822 ENTREZGENE
Gene3D-CATH Phosphorylase Kinase, domain 1 UniProtKB/Swiss-Prot
Transferase(Phosphotransferase) domain 1 UniProtKB/Swiss-Prot
InterPro Kinase-like_dom_sf UniProtKB/Swiss-Prot
Prot_kinase_dom UniProtKB/Swiss-Prot
Protein_kinase_ATP_BS UniProtKB/Swiss-Prot
Ser/Thr_kinase_AS UniProtKB/Swiss-Prot
KEGG Report rno:83825 UniProtKB/Swiss-Prot
NCBI Gene 83825 ENTREZGENE
PANTHER SERINE/THREONINE-PROTEIN KINASE UniProtKB/Swiss-Prot
Pfam Pkinase UniProtKB/Swiss-Prot
PhenoGen Dclk1 PhenoGen
PROSITE PROTEIN_KINASE_ATP UniProtKB/Swiss-Prot
PROTEIN_KINASE_DOM UniProtKB/Swiss-Prot
PROTEIN_KINASE_ST UniProtKB/Swiss-Prot
RatGTEx ENSRNOG00000032922 RatGTEx
SMART S_TKc UniProtKB/Swiss-Prot
Superfamily-SCOP SSF56112 UniProtKB/Swiss-Prot
TIGR TC231457
UniProt A0A0G2KB92 ENTREZGENE, UniProtKB/TrEMBL
A0A1W2Q632_RAT UniProtKB/TrEMBL
A0A1W2Q6Q2 ENTREZGENE, UniProtKB/TrEMBL
A0A3Q9WS43 ENTREZGENE, UniProtKB/TrEMBL
A0A8I5ZWQ8 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6AMY9 ENTREZGENE, UniProtKB/TrEMBL
A0A8L2QB01 ENTREZGENE, UniProtKB/TrEMBL
A6JVF1 ENTREZGENE, UniProtKB/TrEMBL
A6JVF3 ENTREZGENE, UniProtKB/TrEMBL
DCLK1_RAT UniProtKB/Swiss-Prot
M0RDS3 ENTREZGENE, UniProtKB/TrEMBL
O08875 ENTREZGENE
Q9R1P9 ENTREZGENE, UniProtKB/TrEMBL
Q9WVP7 ENTREZGENE, UniProtKB/TrEMBL
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-04-17
Dclk1
doublecortin-like kinase 1
Ania4
activity and neurotransmitter-induced early gene protein 4 (ania-4)
Data merged from RGD:621187
737654 PROVISIONAL
2007-04-03
Dclk1
doublecortin-like kinase 1
Dcamkl1
double cortin and calcium/calmodulin-dependent protein kinase-like 1
Symbol and Name updated to reflect Human and Mouse nomenclature
1299863 APPROVED
2002-08-07
Ania4
activity and neurotransmitter-induced early gene protein 4 (ania-4)
Symbol and Name status set to provisional
70820 PROVISIONAL
2002-06-10
Dcamkl1
double cortin and calcium/calmodulin-dependent protein kinase-like 1
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_function
has protein kinase activity
727578
gene_homology
has similarity to calmodulin dependent protein kinases and to doublecortin
727578
gene_regulation
expression is induced by kainate-elicited seizures in some regions of the hippocampus
631963
