Advanced Search (OLGA)

Gene: Mnat1 (MNAT1 component of CDK activating kinase) Rattus norvegicus

Analyze

Symbol:

Mnat1

Name:

MNAT1 component of CDK activating kinase

RGD ID:

628874

Description:

Predicted to enable cyclin-dependent protein serine/threonine kinase activator activity and zinc ion binding activity. Involved in G1/S transition of mitotic cell cycle; negative regulation of apoptotic process; and positive regulation of smooth muscle cell proliferation. Predicted to be located in chromosome; cytoplasm; and germinal vesicle. Predicted to be part of CAK-ERCC2 complex; transcription factor TFIIH core complex; and transcription factor TFIIK complex. Orthologous to human MNAT1 (MNAT1 component of CDK activating kinase); PARTICIPATES IN RNA polymerase II transcription initiation pathway; nucleotide excision repair pathway; INTERACTS WITH 2,4-dinitrotoluene; 2,6-dinitrotoluene; aflatoxin B1.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

CDK-activating kinase assembly factor MAT1; menage a trois 1; menage a trois homolog 1, cyclin H assembly factor; menage a trois homolog 1, cyclin H assembly factor (Xenopus laevis); MNAT CDK-activating kinase assembly factor 1; MNAT1, CDK activating kinase assembly factor

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MNAT1 (MNAT1 component of CDK activating kinase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Mnat1 (menage a trois 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mnat1 (MNAT1 component of CDK activating kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MNAT1 (MNAT1 component of CDK activating kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MNAT1 (MNAT1 component of CDK activating kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mnat1 (MNAT1 component of CDK activating kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MNAT1 (MNAT1 component of CDK activating kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MNAT1 (MNAT1 component of CDK activating kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mnat1 (MNAT1 component of CDK activating kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Mnat1 (MNAT1 component of CDK activating kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	MNAT1 (MNAT1 component of CDK activating kinase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Mnat1 (menage a trois 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mnat1 (MNAT1 component of CDK activating kinase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mnat-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mnat-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Mat1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	TFB3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	TFB3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mnat1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	97,550,566 - 97,706,598 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	97,550,543 - 97,706,595 (+)	Ensembl				GRCr8
mRatBN7.2	6	91,814,703 - 91,971,945 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	91,814,749 - 91,970,744 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	92,215,265 - 92,360,395 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	92,514,762 - 92,659,893 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	91,942,664 - 92,087,783 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	95,995,341 - 96,153,331 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	96,007,805 - 96,153,330 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	105,442,513 - 105,587,335 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	95,548,845 - 95,698,573 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	90,288,391 - 90,433,268 (+)	NCBI		Celera
RGSC_v3.1	6	95,552,300 - 95,702,028 (+)	NCBI
Cytogenetic Map	6	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-amphetamine (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

4,4'-diaminodiphenylmethane (ISO)

aflatoxin B1 (EXP)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antimycin A (ISO)

antirheumatic drug (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (EXP)

cadmium dichloride (ISO)

captan (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

clofibrate (ISO)

coumarin (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

dioxygen (ISO)

disodium selenite (ISO)

fenpyroximate (ISO)

fenthion (ISO)

folic acid (ISO)

folpet (ISO)

FR900359 (ISO)

genistein (ISO)

gentamycin (EXP)

gold atom (ISO)

gold(0) (ISO)

ivermectin (ISO)

methidathion (ISO)

mono(2-ethylhexyl) phthalate (ISO)

N-methyl-4-phenylpyridinium (ISO)

oxaliplatin (EXP)

paracetamol (EXP)

picoxystrobin (ISO)

rac-lactic acid (ISO)

sodium arsenite (ISO)

sulforaphane (EXP)

tebufenpyrad (ISO)

thioacetamide (EXP)

topotecan (EXP)

trichostatin A (ISO)

triptonide (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adult heart development (ISO)

DNA repair (IBA)

G1/S transition of mitotic cell cycle (IMP)

negative regulation of apoptotic process (IMP)

nucleotide-excision repair (IEA)

positive regulation of smooth muscle cell proliferation (IMP)

regulation of DNA-templated transcription (ISO)

regulation of G1/S transition of mitotic cell cycle (IEA,ISO)

regulation of transcription by RNA polymerase II (IBA,IEA,ISO)

response to calcium ion (ISO)

transcription initiation at RNA polymerase II promoter (IEA,ISO)

ventricular system development (ISO)

Cellular Component

CAK-ERCC2 complex (IEA,ISO)

chromosome (ISO)

cyclin-dependent protein kinase holoenzyme complex (IEA,ISO)

cytoplasm (ISO)

germinal vesicle (ISO)

nucleoplasm (IEA,ISO)

nucleus (IEA)

transcription factor TFIIH core complex (IEA,ISO)

transcription factor TFIIH holo complex (IBA,IEA,ISO)

transcription factor TFIIK complex (IEA,ISO)

Molecular Function

cyclin-dependent protein serine/threonine kinase activator activity (IEA)

metal ion binding (IEA)

protein binding (ISO)

zinc ion binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

nucleotide excision repair pathway (IEA)

RNA polymerase II transcription initiation pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	A history of TFIIH: two decades of molecular biology on a pivotal transcription/repair factor.	Egly JM and Coin F, DNA Repair (Amst). 2011 Jul 15;10(7):714-21. doi: 10.1016/j.dnarep.2011.04.021. Epub 2011 May 17.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Comprehensive gene review and curation	RGD comprehensive gene curation
9.	Information Derived from GenBank Report	RGD, Sept. 2003
10.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
11.	RNA antisense abrogation of MAT1 induces G1 phase arrest and triggers apoptosis in aortic smooth muscle cells.	Wu L, etal., J Biol Chem. 1999 Feb 26;274(9):5564-72.

Additional References at PubMed

PMID:8692841	PMID:8692842	PMID:9852112	PMID:10801852	PMID:11445587	PMID:17276355	PMID:21778139

Genomics

Comparative Map Data

Mnat1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	97,550,566 - 97,706,598 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	97,550,543 - 97,706,595 (+)	Ensembl				GRCr8
mRatBN7.2	6	91,814,703 - 91,971,945 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	91,814,749 - 91,970,744 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	92,215,265 - 92,360,395 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	92,514,762 - 92,659,893 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	91,942,664 - 92,087,783 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	95,995,341 - 96,153,331 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	96,007,805 - 96,153,330 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	105,442,513 - 105,587,335 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	95,548,845 - 95,698,573 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	90,288,391 - 90,433,268 (+)	NCBI		Celera
RGSC_v3.1	6	95,552,300 - 95,702,028 (+)	NCBI
Cytogenetic Map	6	q24	NCBI

MNAT1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	60,734,761 - 60,969,965 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	60,734,742 - 60,969,965 (+)	Ensembl			hg38	GRCh38
GRCh37	14	61,201,479 - 61,436,683 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	60,271,223 - 60,505,151 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	14	60,271,222 - 60,505,151	NCBI
Celera	14	41,251,714 - 41,485,662 (+)	NCBI		Celera
Cytogenetic Map	14	q23.1	NCBI
HuRef	14	41,364,391 - 41,598,757 (+)	NCBI		HuRef
CHM1_1	14	61,140,780 - 61,374,681 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	54,941,243 - 55,176,505 (+)	NCBI		T2T-CHM13v2.0

Mnat1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	73,158,957 - 73,320,762 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	73,170,491 - 73,320,762 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	12	73,112,185 - 73,273,988 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	73,123,717 - 73,273,988 (+)	Ensembl			mm10	GRCm38
MGSCv37	12	74,224,704 - 74,374,975 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	12	74,042,567 - 74,191,687 (+)	NCBI		MGSCv36	mm8
Celera	12	74,235,147 - 74,385,303 (+)	NCBI		Celera
Cytogenetic Map	12	C3	NCBI
cM Map	12	30.37	NCBI

Mnat1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955466	8,690,960 - 8,895,021 (-)	Ensembl
ChiLan1.0	NW_004955466	8,690,960 - 8,895,021 (-)	NCBI	ChiLan1.0	ChiLan1.0

MNAT1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	61,872,516 - 62,105,486 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	61,089,035 - 61,321,999 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	41,342,530 - 41,576,690 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	59,603,209 - 59,835,408 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	59,603,209 - 59,835,408 (+)	Ensembl			panPan2	panpan1.1

MNAT1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	35,747,883 - 35,946,353 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	35,756,933 - 35,946,353 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	35,510,966 - 35,699,760 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	35,990,042 - 36,179,803 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	35,990,189 - 36,179,799 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	35,602,177 - 35,790,354 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	35,679,632 - 35,867,792 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	36,041,067 - 36,229,645 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Mnat1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	69,063,584 - 69,282,287 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936495	4,909,380 - 5,128,113 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936495	4,909,427 - 5,128,113 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MNAT1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	189,690,354 - 189,910,589 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	1	189,690,343 - 189,908,144 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	210,944,891 - 210,956,358 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MNAT1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	37,922,347 - 38,161,467 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	37,922,353 - 38,162,226 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666053	26,174,914 - 26,419,489 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mnat1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624734	40,154,577 - 40,389,402 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624734	40,148,761 - 40,389,233 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Mnat1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	7	87,388,057 - 87,530,683 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Mnat1
743 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	268
Count of miRNA genes:	187
Interacting mature miRNAs:	206
Transcripts:	ENSRNOT00000010163
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	71278722	116278722	Rat
70176	Mcsm1	Mammary carcinoma susceptibility modifier QTL 1			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	64367996	109367996	Rat
2293088	Iddm28	Insulin dependent diabetes mellitus QTL 28	5.21		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	6	68767270	135411972	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	88019181	136741135	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	93560258	136550638	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	90871046	135871046	Rat
724524	Uae2	Urinary albumin excretion QTL 2	2.7	0.0005	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	79198463	144254945	Rat
4889933	Bss88	Bone structure and strength QTL 88	3.8		tibia size trait (VT:0100001)	tibia total bone volume (CMO:0001724)	6	53684921	98684921	Rat
737827	Hcar11	Hepatocarcinoma resistance QTL 11	4.4		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	6	46050607	116278722	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	93778632	138778632	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	20859430	113082285	Rat
2293837	Kiddil1	Kidney dilation QTL 1	3.7		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	86867923	110125012	Rat
2293842	Kiddil3	Kidney dilation QTL 3	4.3		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	86867923	110125012	Rat
61329	Eae9	Experimental allergic encephalomyelitis QTL 9	3.7		body mass (VT:0001259)	change in body weight (CMO:0002045)	6	84490437	129490437	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	90871046	135871046	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	93560258	136550638	Rat
5684963	Bss99	Bone structure and strength QTL 99	3.1		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	6	53684921	98684921	Rat
1576302	Schws4	Schwannoma susceptibility QTL 4		0.0078	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	78204640	123204640	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	93560258	136550638	Rat
5684992	Bmd83	Bone mineral density QTL 82	4.8		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	6	53684921	98684921	Rat
1300075	Glom7	Glomerulus QTL 7	5.6	0.0000002	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	6	76937178	121937178	Rat
1331789	Rf37	Renal function QTL 37	3.224		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	86494122	112380234	Rat

Markers in Region

D6Got118

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	6	97,676,514 - 97,676,639 (+)	Marker Load Pipeline
mRatBN7.2	6	91,940,658 - 91,940,783 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	96,123,145 - 96,123,269	NCBI	Rnor6.0
Rnor_5.0	6	105,557,501 - 105,557,625	UniSTS	Rnor5.0
RGSC_v3.4	6	95,666,280 - 95,666,405	RGD	RGSC3.4
RGSC_v3.4	6	95,666,281 - 95,666,405	UniSTS	RGSC3.4
Celera	6	90,403,082 - 90,403,206	UniSTS
RGSC_v3.1	6	95,669,737 - 95,669,861	RGD
RH 3.4 Map	6	661.4	UniSTS
RH 3.4 Map	6	661.4	RGD
Cytogenetic Map	6	q24	UniSTS

BE120601

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	91,966,552 - 91,966,728 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	96,149,140 - 96,149,315	NCBI	Rnor6.0
Rnor_5.0	6	105,583,144 - 105,583,319	UniSTS	Rnor5.0
RGSC_v3.4	6	95,694,382 - 95,694,557	UniSTS	RGSC3.4
Celera	6	90,429,077 - 90,429,252	UniSTS
RH 3.4 Map	6	657.7	UniSTS
Cytogenetic Map	6	q24	UniSTS

AI008314

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	91,840,783 - 91,840,964 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	96,023,311 - 96,023,491	NCBI	Rnor6.0
Rnor_5.0	6	105,458,019 - 105,458,199	UniSTS	Rnor5.0
RGSC_v3.4	6	95,564,920 - 95,565,100	UniSTS	RGSC3.4
Celera	6	90,303,861 - 90,304,041	UniSTS
RH 3.4 Map	6	661.5	UniSTS
Cytogenetic Map	6	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_153472	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017594051	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063261569	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063261570	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY135567	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC078712	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010163 ⟹ ENSRNOP00000010163

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	97,550,543 - 97,706,549 (+)	Ensembl
mRatBN7.2 Ensembl	6	91,814,749 - 91,970,742 (+)	Ensembl
Rnor_6.0 Ensembl	6	96,007,805 - 96,153,330 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000102762 ⟹ ENSRNOP00000097795

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	97,550,543 - 97,674,460 (+)	Ensembl
mRatBN7.2 Ensembl	6	91,814,749 - 91,938,812 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107749 ⟹ ENSRNOP00000083064

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	97,550,543 - 97,686,743 (+)	Ensembl
mRatBN7.2 Ensembl	6	91,814,749 - 91,898,221 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114452 ⟹ ENSRNOP00000084909

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	97,588,911 - 97,706,595 (+)	Ensembl
mRatBN7.2 Ensembl	6	91,853,034 - 91,970,744 (+)	Ensembl

RefSeq Acc Id:

NM_153472 ⟹ NP_703202

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	97,561,156 - 97,706,598 (+)	NCBI
mRatBN7.2	6	91,825,283 - 91,970,744 (+)	NCBI
Rnor_6.0	6	96,007,805 - 96,153,331 (+)	NCBI
Rnor_5.0	6	105,442,513 - 105,587,335 (+)	NCBI
RGSC_v3.4	6	95,548,845 - 95,698,573 (+)	RGD
Celera	6	90,288,391 - 90,433,268 (+)	RGD

Sequence:

show sequence

GTGGCAGTGGCTGAAGCTGGCGTTGGGGGGAAAATCCAAAGCTGAGGAGACGCCATGGACGACC
AGGGCTGCCCCAGGTGTAAGACCACCAAATACCGGAACCCTTCTTTGAAGCTGATGGTGAACGT
GTGCGGACACACACTGTGTGAGAGTTGTGTGGACTTACTGTTTGTAAGAGGAGCTGGAAACTGT
CCGGAGTGTGGCACTCCACTGAGAAAGAGCAACTTTAGGGTACAGCTCTTTGAAGATCCCACTG
TTGACAAGGAGGTTGAAATTCGGAAAAAAGTACTAAAGATATACAATAAAAGGGAAGAAGATTT
TCCTAGTTTAAGAGAGTATAATGATTTTCTGGAAGAAGTGGAGGAAATCGTTTTCAATTTGACC
AACAACGTGGATTTGGAGAACACTAAAAAGAAAATGGAAATATATCAAAAAGAAAACAAAGATG
TCATTCAGAAAAATAAATTAAAGCTGACTCGGGAGCAGGAGGAATTGGAGGAAGCATTGGAGGT
AGAACGCCAAGAAAGTGAACAACGACGACTGTTTATTCAAAAGGAAGAAGAGCTGCAGCAGATT
CTGAAAAGGAAGAACAAGCAGGCCTTTTTAGATGAGCTGGAGAGCTCCGACCTCCCTGTCGCTC
TGCTCTTGGCTCAGCATAAAGACAGATCTACCCAGCTGGAAATGCAGCTTGAGAAGCCCAAATC
CATGAAGCCGGTGACATTTTCCACAGGAATTAAAATGGGTCAACAGATTTCGTTAGCACCAATC
CAAAAGCTTGAGGAAGCTCTCTATGAATACCAGCCCCTGCAGATAGAGACCTGTGGACCCCAAG
TTCCTGAACAAGAGCTGCTAGGAAGACTTGGGTATTTGAACCACGTCCGAGCTGCATCTCCACA
GGATCTAGCTGGCGGCTATACTTCTTCTCTTGCTTGTCACAGAGCGCTACAGGATGCATTCAGT
GGGCTTTTCTGGCAGCCCAGATAGCCTGTATTTTCTCATTTATAAAATCTGGATCTTGGAACCA
AACCAAGGGGTTTGGAAGTAAAGAAATTTGTAAAGTCCCAGCCCACGCAGCTGCACAGCACACC
ACCGCTGGCTGCTGTGTTCAGGTGTTTATGGCAGTCTGGACCAAGCTGAGAAATGTGTTGCATA
TAGATTCATGGAAGAGATTTATTTTTTACTTCTATTCTTCAGACAGGGATCGAAGCATTGAACC
TCATATAACAAGAAAGAAATAAATGATTTGCCTATGTATGGTGTTGACATACATTTTTTAAAAC
AATAAAGCTTGACTTTATGATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063261569 ⟹ XP_063117639

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	97,550,566 - 97,637,890 (+)	NCBI

RefSeq Acc Id:

XM_063261570 ⟹ XP_063117640

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	97,561,068 - 97,706,598 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_703202	(Get FASTA)	NCBI Sequence Viewer
	XP_063117639	(Get FASTA)	NCBI Sequence Viewer
	XP_063117640	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH78712	(Get FASTA)	NCBI Sequence Viewer
	AAN10147	(Get FASTA)	NCBI Sequence Viewer
	EDM03609	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010163
	ENSRNOP00000010163.4
	ENSRNOP00000083064.2
	ENSRNOP00000084909.1
	ENSRNOP00000097795.1

RefSeq Acc Id:

NP_703202 ⟸ NM_153472

- UniProtKB:

Q8CIR5 (UniProtKB/TrEMBL), A6HC54 (UniProtKB/TrEMBL), Q6AZ68 (UniProtKB/TrEMBL), A0A8I5ZYY1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFE
DPTVDKEVEIRKKVLKIYNKREEDFPSLREYNDFLEEVEEIVFNLTNNVDLENTKKKMEIYQKE
NKDVIQKNKLKLTREQEELEEALEVERQESEQRRLFIQKEEELQQILKRKNKQAFLDELESSDL
PVALLLAQHKDRSTQLEMQLEKPKSMKPVTFSTGIKMGQQISLAPIQKLEEALYEYQPLQIETC
GPQVPEQELLGRLGYLNHVRAASPQDLAGGYTSSLACHRALQDAFSGLFWQPR

hide sequence

Ensembl Acc Id:

ENSRNOP00000010163 ⟸ ENSRNOT00000010163

Ensembl Acc Id:

ENSRNOP00000083064 ⟸ ENSRNOT00000107749

Ensembl Acc Id:

ENSRNOP00000097795 ⟸ ENSRNOT00000102762

Ensembl Acc Id:

ENSRNOP00000084909 ⟸ ENSRNOT00000114452

RefSeq Acc Id:	XP_063117639 ⟸ XM_063261569
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZV40 (UniProtKB/TrEMBL), A0A8I6ATM4 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063117640 ⟸ XM_063261570
- Peptide Label:	isoform X2
- UniProtKB:	F7EX11 (UniProtKB/TrEMBL), A0A8I5ZYY1 (UniProtKB/TrEMBL)

Protein Domains

MAT1 C-terminal CAK anchor MAT1 centre RING-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8CIR5-F1-model_v2	AlphaFold	Q8CIR5	1-309	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694663

Promoter ID:

EPDNEW_R5187

Type:

initiation region

Name:

Mnat1_1

Description:

MNAT1, CDK activating kinase assembly factor

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	96,007,744 - 96,007,804	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:628874	AgrOrtholog
BioCyc Gene	G2FUF-37117	BioCyc
Ensembl Genes	ENSRNOG00000007267	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000010163	ENTREZGENE
	ENSRNOT00000010163.7	UniProtKB/TrEMBL
	ENSRNOT00000102762.2	UniProtKB/TrEMBL
	ENSRNOT00000107749.2	UniProtKB/TrEMBL
	ENSRNOT00000114452.2	UniProtKB/TrEMBL
Gene3D-CATH	3.30.40.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7128354	IMAGE-MGC_LOAD
InterPro	Cdk-activating_kinase_MAT1	UniProtKB/TrEMBL
	MAT1	UniProtKB/TrEMBL
	MAT1_CAK-anch	UniProtKB/TrEMBL
	Ubiquitin-int_motif	UniProtKB/TrEMBL
	Znf_RING	UniProtKB/TrEMBL
	Znf_RING/FYVE/PHD	UniProtKB/TrEMBL
	Znf_RING_CS	UniProtKB/TrEMBL
KEGG Report	rno:266713	UniProtKB/TrEMBL
MGC_CLONE	MGC:93132	IMAGE-MGC_LOAD
NCBI Gene	266713	ENTREZGENE
PANTHER	CDK-ACTIVATING KINASE ASSEMBLY FACTOR MAT1	UniProtKB/TrEMBL
	PTHR12683:SF13	UniProtKB/TrEMBL
Pfam	CAK-anch_MAT1	UniProtKB/TrEMBL
	MAT1	UniProtKB/TrEMBL
	zf-C3HC4_5	UniProtKB/TrEMBL
PhenoGen	Mnat1	PhenoGen
PIRSF	MAT1_metazoa	UniProtKB/TrEMBL
PROSITE	UIM	UniProtKB/TrEMBL
	ZF_RING_1	UniProtKB/TrEMBL
	ZF_RING_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000007267	RatGTEx
SMART	RING	UniProtKB/TrEMBL
Superfamily-SCOP	RING/U-box	UniProtKB/TrEMBL
UniProt	A0A8I5ZV40	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZYY1	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6ATM4	ENTREZGENE, UniProtKB/TrEMBL
	A6HC54	ENTREZGENE, UniProtKB/TrEMBL
	F7EX11	ENTREZGENE, UniProtKB/TrEMBL
	Q6AZ68	ENTREZGENE, UniProtKB/TrEMBL
	Q8CIR5	ENTREZGENE
UniProt Secondary	Q8CIR5	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-04-04	Mnat1	MNAT1 component of CDK activating kinase	Mnat1	MNAT1, CDK activating kinase assembly factor	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2017-03-29	Mnat1	MNAT1, CDK activating kinase assembly factor	Mnat1	MNAT CDK-activating kinase assembly factor 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-08-14	Mnat1	MNAT CDK-activating kinase assembly factor 1	Mnat1	menage a trois homolog 1, cyclin H assembly factor (Xenopus laevis)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Mnat1	menage a trois homolog 1, cyclin H assembly factor (Xenopus laevis)	Mnat1	menage a trois 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Mnat1	menage a trois 1			Symbol and Name status set to approved	1299863	APPROVED
2003-02-27	Mnat1	menage a trois 1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

RGD Manual Annotations

Imported Annotations - KEGG (archival)