P3h1 (prolyl 3-hydroxylase 1) - Rat Genome Database

Name: P3h1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: P3h1 (prolyl 3-hydroxylase 1) Rattus norvegicus

Analyze

Symbol:

P3h1

Name:

prolyl 3-hydroxylase 1

RGD ID:

628823

Description:

Predicted to enable procollagen-proline 3-dioxygenase activity. Involved in positive regulation of neuron projection development. Located in basement membrane. Human ortholog(s) of this gene implicated in osteogenesis imperfecta type 8. Orthologous to human P3H1 (prolyl 3-hydroxylase 1); INTERACTS WITH 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine; 2,3,7,8-tetrachlorodibenzodioxine; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Gros1; growth supressor 1; Lepre1; leprecan; leprecan 1; leprecan-1; leucine proline-enriched proteoglycan (leprecan) 1; leucine- and proline-enriched proteoglycan 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	P3H1 (prolyl 3-hydroxylase 1)	HGNC	Ensembl, HomoloGene, NCBI, Panther
Mus musculus (house mouse):	P3h1 (prolyl 3-hydroxylase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	P3h1 (prolyl 3-hydroxylase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	P3H1 (prolyl 3-hydroxylase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	P3H1 (prolyl 3-hydroxylase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	P3h1 (prolyl 3-hydroxylase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	P3H1 (prolyl 3-hydroxylase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	P3H1 (prolyl 3-hydroxylase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	P3h1 (prolyl 3-hydroxylase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	P3h1 (prolyl 3-hydroxylase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	P3H1 (prolyl 3-hydroxylase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	p3h1 (prolyl 3-hydroxylase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	p3h1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	138,127,240 - 138,141,974 (+)	NCBI		GRCr8
mRatBN7.2	5	132,841,868 - 132,856,664 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	132,841,928 - 132,856,659 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	135,569,568 - 135,584,262 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	137,326,032 - 137,340,722 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	137,346,618 - 137,361,308 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	138,279,597 - 138,294,280 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	138,279,506 - 138,294,262 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	142,091,640 - 142,106,916 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	139,816,323 - 139,831,409 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	139,821,548 - 139,836,635 (+)	NCBI
Celera	5	131,367,576 - 131,382,262 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Charcot-Marie-Tooth disease dominant intermediate C (ISO)

genetic disease (ISO)

glucose transporter type 1 deficiency syndrome 1 (ISO)

osteogenesis imperfecta (ISO)

osteogenesis imperfecta type 3 (ISO)

osteogenesis imperfecta type 8 (ISO,ISS)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine (EXP)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-amino-14,16-dimethyloctadecan-3-ol (ISO)

2-methylcholine (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

ammonium chloride (EXP)

atrazine (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

carbon nanotube (ISO)

corticosterone (EXP)

Cuprizon (EXP)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

glafenine (EXP)

hydrogen cyanide (ISO)

inulin (ISO)

ivermectin (ISO)

oxaliplatin (EXP)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

potassium cyanide (ISO)

propiconazole (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

tetrachloromethane (ISO)

thapsigargin (ISO)

thiram (ISO)

titanium dioxide (ISO)

topotecan (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

bone development (IEA,ISO)

collagen fibril organization (ISO)

collagen metabolic process (IBA,IEA)

negative regulation of cell growth (ISO)

negative regulation of post-translational protein modification (IEA,ISO)

positive regulation of neuron projection development (IDA)

protein folding (IEA,ISO)

protein hydroxylation (ISO)

protein stabilization (IEA,ISO)

regulation of ossification (ISO)

regulation of protein secretion (IEA,ISO)

Cellular Component

basement membrane (IDA)

cytoplasm (ISO)

endoplasmic reticulum (IBA,IEA,ISO)

extracellular region (IEA)

nucleus (ISO)

Molecular Function

dioxygenase activity (IEA)

iron ion binding (IEA)

L-ascorbic acid binding (IEA)

oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (IEA)

procollagen-proline 3-dioxygenase activity (IBA,IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	A multilevel screening strategy defines a molecular fingerprint of proregenerative olfactory ensheathing cells and identifies SCARB2, a protein that improves regenerative sprouting of injured sensory spinal axons.	Roet KC, etal., J Neurosci. 2013 Jul 3;33(27):11116-35. doi: 10.1523/JNEUROSCI.1002-13.2013.
8.	Molecular characterization of a novel basement membrane-associated proteoglycan, leprecan.	Wassenhove-McCarthy DJ and McCarthy KJ, J Biol Chem 1999 Aug 27;274(35):25004-17.

Additional References at PubMed

PMID:1095156	PMID:10951563	PMID:12477932	PMID:17277775	PMID:17495866	PMID:19056867	PMID:19846465	PMID:19946888	PMID:20089953	PMID:20363744	PMID:22615817

Genomics

Comparative Map Data

P3h1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	138,127,240 - 138,141,974 (+)	NCBI		GRCr8
mRatBN7.2	5	132,841,868 - 132,856,664 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	132,841,928 - 132,856,659 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	135,569,568 - 135,584,262 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	137,326,032 - 137,340,722 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	137,346,618 - 137,361,308 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	138,279,597 - 138,294,280 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	138,279,506 - 138,294,262 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	142,091,640 - 142,106,916 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	139,816,323 - 139,831,409 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	139,821,548 - 139,836,635 (+)	NCBI
Celera	5	131,367,576 - 131,382,262 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

P3H1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	42,746,374 - 42,767,028 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	42,746,335 - 42,767,084 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	43,212,045 - 43,232,699 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	42,984,633 - 43,005,270 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	1	41,493,937 - 41,514,687 (-)	NCBI		Celera
Cytogenetic Map	1	p34.2	NCBI
HuRef	1	41,331,989 - 41,352,738 (-)	NCBI		HuRef
CHM1_1	1	43,328,805 - 43,349,560 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	42,616,864 - 42,637,518 (-)	NCBI		T2T-CHM13v2.0

P3h1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	119,090,112 - 119,106,174 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	119,090,112 - 119,106,172 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	119,232,915 - 119,248,977 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	119,232,915 - 119,248,975 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	118,905,520 - 118,921,582 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	118,730,878 - 118,746,299 (+)	NCBI		MGSCv36	mm8
Celera	4	117,960,655 - 117,976,715 (+)	NCBI		Celera
Cytogenetic Map	4	D2.1	NCBI
cM Map	4	55.34	NCBI

P3h1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955537	2,275,599 - 2,292,303 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955537	2,276,080 - 2,292,303 (-)	NCBI	ChiLan1.0	ChiLan1.0

P3H1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	184,045,565 - 184,065,311 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	183,187,228 - 183,206,973 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	42,046,128 - 42,065,718 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	43,423,579 - 43,443,443 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	43,423,900 - 43,443,336 (-)	Ensembl	panpan1.1		panPan2

P3H1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	603,436 - 621,839 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	603,329 - 621,568 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	859,084 - 876,791 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	685,742 - 703,402 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	685,532 - 703,398 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	595,219 - 612,872 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	656,713 - 674,330 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	671,787 - 689,446 (+)	NCBI		UU_Cfam_GSD_1.0

P3h1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	58,252,481 - 58,268,592 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	24,075,312 - 24,093,399 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	24,077,270 - 24,093,399 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

P3H1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	168,668,311 - 168,687,829 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	168,668,275 - 168,687,832 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	156,143,283 - 156,159,092 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

P3H1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	90,166,622 - 90,185,802 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	90,166,700 - 90,186,115 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	26,724,625 - 26,743,984 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

P3h1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624892	1,988,096 - 2,003,319 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624892	1,988,309 - 2,003,285 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in P3h1
85 total Variants

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	97059760	147465714	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
1300122	Wbc1	White blood cell count QTL 1	2.75		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	5	125392826	139989768	Rat
7365049	Bp359	Blood pressure QTL 359			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128071929	134724733	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	94858972	143070159	Rat
70156	Niddm30	Non-insulin dependent diabetes mellitus QTL 30	3.98		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	5	129132447	151006154	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
1331803	Rf32	Renal function QTL 32	2.798		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	129132428	143070159	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	132717196	165560427	Rat
1581505	Rf54	Renal function QTL 54			kidney physiology trait (VT:0002136)	kidney 20-HETE level (CMO:0001854)	5	128033842	133011550	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
2317753	Glom24	Glomerulus QTL 24	3.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	5	97570330	136479578	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	120740824	143608494	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	105999803	150999803	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
7394710	Emca12	Estrogen-induced mammary cancer QTL 12			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	124160767	133749643	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	120740824	151018848	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
1578673	Bmd13	Bone mineral density QTL 13	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	5	103689353	148689353	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
631527	Tls1	T-lymphoma susceptibility QTL 1	0	0.001	thymus integrity trait (VT:0010555)	post-insult time to onset of T-cell lymphoma (CMO:0001907)	5	90450144	135450144	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	99216724	148607142	Rat

Markers in Region

RH142387

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RH 3.4 Map	5	867.1	UniSTS
Cytogenetic Map	5	q36	UniSTS

RH143026

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	132,843,041 - 132,843,156 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	138,280,666 - 138,280,780	NCBI	Rnor6.0
Rnor_5.0	5	142,092,709 - 142,092,823	UniSTS	Rnor5.0
RGSC_v3.4	5	139,817,392 - 139,817,506	UniSTS	RGSC3.4
Celera	5	131,368,645 - 131,368,759	UniSTS
RH 3.4 Map	5	866.3	UniSTS
Cytogenetic Map	5	q36	UniSTS

Lepre1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	132,856,190 - 132,856,588 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	138,293,811 - 138,294,208	NCBI	Rnor6.0
Rnor_5.0	5	142,106,447 - 142,106,844	UniSTS	Rnor5.0
RGSC_v3.4	5	139,830,940 - 139,831,337	UniSTS	RGSC3.4
Celera	5	131,381,793 - 131,382,190	UniSTS
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053667	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC098918	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF087433	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC161838	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000084651 ⟹ ENSRNOP00000071755

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	132,841,928 - 132,856,659 (+)	Ensembl
Rnor_6.0 Ensembl	5	138,279,506 - 138,294,262 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000115880 ⟹ ENSRNOP00000084204

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	132,841,928 - 132,856,545 (+)	Ensembl

RefSeq Acc Id:

NM_053667 ⟹ NP_446119

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	138,127,240 - 138,141,974 (+)	NCBI
mRatBN7.2	5	132,841,928 - 132,856,664 (+)	NCBI
Rnor_6.0	5	138,279,597 - 138,294,280 (+)	NCBI
Rnor_5.0	5	142,091,640 - 142,106,916 (+)	NCBI
RGSC_v3.4	5	139,816,323 - 139,831,409 (+)	RGD
Celera	5	131,367,576 - 131,382,262 (+)	RGD

Sequence:

show sequence

GGAATTCGGCACGATGGTAGCGGTCGCCGCAGCCGCCGCCTCGCGGGCTACCGCGGAGTCTGAG
CCGGAATGGAACGTGGCAGCCCCTGACCTACTTTACGCAGAGGGGACGGCGGCCTACGCGCGCG
GGGACTGGCCCGGGGTGGTACTGAACATGGAGCGGGCTCTGCGCTCGCGGGCCGCTCTGCGCGC
CCTCCGCCTGCGCTGCCGCACACGCTGCGCCACCGAGCTGCCGTGGGCGCCGGACCTCGATCTC
GGTCCGGCCTCGAGTCTGAACCACGACCCGGGCGCTGCCGCCTTGCACGACCTTCGCTTCTTCG
GAGCCCTGCTGCGCCGTGCCGCCTGCCTGCGTCGCTGCCTCGGGCCGCCTTCTGCCCACTTGTT
GAGTGAAGAGCTGGACCTGGAGTTCAACAAGCGGAGCCCGTACAACTACCTGCAGGTCGCCTAT
TTCAAGATAAACAAGCTGGAAAAAGCCGTGGCAGCAGCACACACCTTCTTTGTGGGCAATCCTG
AGCACATGGAAATGCGGCAGAACCTCGACTACTACCAAACCATGTCTGGGGTAAAGGAGGAAGA
CTTCAAGGACCTCGAGGCCAAGCCCCACATGCATGAGTTTCGGCTAGGGGTGCGACTCTACTCT
GAGGAGAAGCCACTGGAAGCTGTGCCCCACCTGGAGGCGGCGTTGCAAGAGTACTTTGTGGCAG
ATGAGGAGTGCCGTGCCCTCTGCGAAGGGCCCTATGACTACGACGGCTACAACTACCTAGACTA
CAGCGCTGACCTCTTCCAGGCCATCACAGATCATTACGTCCAGGTCCTCAGCTGTAAGCAGAAC
TGTGTCACCGAGCTGGCTTCCCACCCAAGTCGAGAAAAGCCTTTTGAAGACTTCCTCCCCTCAC
ACTATAATTACCTACAGTTTGCCTACTATAACATTGGGAACTATACACAAGCTATTGAATGTGC
CAAGACCTACCTCCTCTTCTTCCCCAATGATGAGGTGATGAGTCAGAACCTGGCTTACTATACA
GCCGTGCTTGGAGAAGAGGAGGCCAGCTCCATCAGTCCCCGGGAGAATGCCCAGGAATACCGAC
ATCGAAGCCTGCTGGAGAAAGAACTGCTTTTCTTCGCTTATGACATTTTCGGAATTCCCTTTGT
GGATCCGGACTCATGGACACCAGAAGAGGTGATTCCCAAGAGACTGCAAGAGAAACAAAAGTCA
GAACGCGAAACCGCAGTCCGCATCTCCCAGGAGATAGGCAACCTCATGAAGGAGATCGAGACCC
TCGTGGAGGAGAAGACGAAGGAGTCGCTGGATGTGAGCAGACTGACACGGGAAGGTGGTCCCTT
ACTGTATGAAGGCATCAATCTCACTATGAACTCCAAAGTCTTGAACGGCTCCCAGCGAGTGGTG
ATGGATGGTGTGATCTCTGATGACGAGTGCCAGGAACTGCAGAGACTGACCAACGCAGCAGCAA
CTTCAGGAGATGGCTATCGAGGTCAGACCTCCCCACACACCCCAAATGAAAAGTTCTATGGTGT
CACTGTCCTCAAAGCTCTCAAGCTTGGGCAGGAAGGGAAAGTTCCTCTGCAGAGCGCCCACATG
TACTACAACGTGACAGAGAAGGTTCGGCGTGTCATGGAGTCCTACTTCCGCCTGGACACACCCC
TCTACTTCTCCTACTCCCACCTAGTGTGCCGCACTGCAATAGAAGAGTCACAGGCTGAGAGGAA
GGACAGTAGCCACCCTGTCCATGTGGATAACTGCATTCTGAATGCCGAATCCCTCGTGTGTATC
AAGGAGCCCCCAGCCTATACGTTCCGGGACTACAGCGCCATCCTCTACCTCAATGGGGACTTCG
ATGGAGGAAACTTCTACTTCACAGAACTAGATGCCAAGACTGTGACGGCAGAGGTGCAGCCCCA
GTGTGGAAGGGCTGTGGGATTCTCTTCCGGCACCGAGAACCCACATGGAGTGAAGGCTGTCACC
AGGGGGCAGCGCTGCGCCATCGCCCTGTGGTTCACGCTGGATCCTCGGCACAGTGAGAGAGACA
GGGTACAGGCAGATGACCTGGTGAAGATGCTCTTCAGCCCAGAAGAGGTGGACCTCCCCCAGGA
GCAGCCCCTGCCTGACCAACAGGGCTCCCCGAAACCTGGAGAAGAGTCTCTGTCCGACAGAGAG
TCACAGCCCAAGGATGAGCTATGACAGCAGCTAGGTCGCAGTTGATGTCGCTGGACCCATGGGG
GGAACTCAGTCCTGCAGCCTGGACTTCCCAGACCCTGAAGGCTGCAGAGTAAGGGGCACTTCTG
TTTGCTGCCCGGCCCGAGGACCCTGCCCACAGCCTTCTTCATGGTGCTGCTGTTCTCGGAGGAG
TGGGCATGGCAGGACACACTCTTCTCTGTGCTTCACTGAAGGCTCAGGATGTAGGCCCAGAACC
ACCTGGGGCCTATGGAGGCAGCTGCCTGTCGGCAGCATGATGTATTTAAGTGTCTGTAGAGACA
GCCAAAGAATAAATGATTTGTTTTTTCA

hide sequence

Protein Sequences


Protein RefSeqs	NP_446119	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD51875	(Get FASTA)	NCBI Sequence Viewer
	AAI61838	(Get FASTA)	NCBI Sequence Viewer
	EDL90130	(Get FASTA)	NCBI Sequence Viewer
	EDL90131	(Get FASTA)	NCBI Sequence Viewer
	EDL90132	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000071755.2
	ENSRNOP00000084204.1
GenBank Protein	Q9R1J8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_446119 ⟸ NM_053667
- Peptide Label:	precursor
- UniProtKB:	A6JZM2 (UniProtKB/TrEMBL), A0A0G2K199 (UniProtKB/TrEMBL)
- Sequence:	show sequence MVAVAAAAASRATAESEPEWNVAAPDLLYAEGTAAYARGDWPGVVLNMERALRSRAALRALRLR CRTRCATELPWAPDLDLGPASSLNHDPGAAALHDLRFFGALLRRAACLRRCLGPPSAHLLSEEL DLEFNKRSPYNYLQVAYFKINKLEKAVAAAHTFFVGNPEHMEMRQNLDYYQTMSGVKEEDFKDL EAKPHMHEFRLGVRLYSEEKPLEAVPHLEAALQEYFVADEECRALCEGPYDYDGYNYLDYSADL FQAITDHYVQVLSCKQNCVTELASHPSREKPFEDFLPSHYNYLQFAYYNIGNYTQAIECAKTYL LFFPNDEVMSQNLAYYTAVLGEEEASSISPRENAQEYRHRSLLEKELLFFAYDIFGIPFVDPDS WTPEEVIPKRLQEKQKSERETAVRISQEIGNLMKEIETLVEEKTKESLDVSRLTREGGPLLYEG INLTMNSKVLNGSQRVVMDGVISDDECQELQRLTNAAATSGDGYRGQTSPHTPNEKFYGVTVLK ALKLGQEGKVPLQSAHMYYNVTEKVRRVMESYFRLDTPLYFSYSHLVCRTAIEESQAERKDSSH PVHVDNCILNAESLVCIKEPPAYTFRDYSAILYLNGDFDGGNFYFTELDAKTVTAEVQPQCGRA VGFSSGTENPHGVKAVTRGQRCAIALWFTLDPRHSERDRVQADDLVKMLFSPEEVDLPQEQPLP DQQGSPKPGEESLSDRESQPKDEL hide sequence

Ensembl Acc Id:

ENSRNOP00000071755 ⟸ ENSRNOT00000084651

Ensembl Acc Id:

ENSRNOP00000084204 ⟸ ENSRNOT00000115880

Protein Domains

Fe2OG dioxygenase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9R1J8-F1-model_v2	AlphaFold	Q9R1J8	1-728	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693979

Promoter ID:

EPDNEW_R4503

Type:

initiation region

Name:

P3h1_1

Description:

prolyl 3-hydroxylase 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	138,279,539 - 138,279,599	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:628823	AgrOrtholog
BioCyc Gene	G2FUF-40093	BioCyc
BioCyc Pathway	PWY-7894 [procollagen hydroxylation and glycosylation]	BioCyc
BioCyc Pathway Image	PWY-7894	BioCyc
Ensembl Genes	ENSRNOG00000053991	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000084651.2	UniProtKB/TrEMBL
	ENSRNOT00000115880.1	UniProtKB/TrEMBL
Gene3D-CATH	1.25.40.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	q2cbj1_9rhob like domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:9101602	IMAGE-MGC_LOAD
InterPro	Oxoglu/Fe-dep_dioxygenase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	P3H	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Pro_4_hyd_alph	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Pro_4_hyd_alph_FE2OG_OXY	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TPR-like_helical_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:114200	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:187347	IMAGE-MGC_LOAD
NCBI Gene	114200	ENTREZGENE
PANTHER	PTHR14049	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR14049:SF5	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	2OG-FeII_Oxy_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	P3h1	PhenoGen
PROSITE	ER_TARGET	UniProtKB/Swiss-Prot
	FE2OG_OXY	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000053991	RatGTEx
SMART	P4Hc	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2K199	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZYN5_RAT	UniProtKB/TrEMBL
	A6JZM1_RAT	UniProtKB/TrEMBL
	A6JZM2	ENTREZGENE, UniProtKB/TrEMBL
	P3H1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-12-17	P3h1	prolyl 3-hydroxylase 1	Lepre1	leucine proline-enriched proteoglycan (leprecan) 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-11-04	Lepre1	leucine proline-enriched proteoglycan (leprecan) 1	Lepre1	leprecan 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Lepre1	leprecan 1		leprecan	Name updated	1299863	APPROVED
2003-02-27	Lepre1	leprecan			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains conserved proteoglycan motifs, and an endoplasmic reticulum retrieval signal, KDEL	633221

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

BioCyc Pathways