Symbol:
Aptx
Name:
aprataxin
RGD ID:
628740
Description:
Predicted to enable several functions, including DNA binding activity; double-stranded RNA binding activity; and hydrolase activity, acting on ester bonds. Predicted to be involved in regulation of protein stability and single strand break repair. Predicted to be located in chromatin; nucleolus; and nucleoplasm. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in ataxia with oculomotor apraxia type 1 and olivopontocerebellar atrophy. Orthologous to human APTX (aprataxin); PARTICIPATES IN non-homologous end joining pathway of double-strand break repair; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; ammonium chloride; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
FHA-HIT; forkhead-associated domain histidine triad-like protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
APTX (aprataxin) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB
Mus musculus (house mouse):
Aptx (aprataxin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Aptx (aprataxin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
APTX (aprataxin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
APTX (aprataxin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Aptx (aprataxin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
APTX (aprataxin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
APTX (aprataxin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Aptx (aprataxin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Aptx (aprataxin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
APTX (aprataxin)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
aptx (aprataxin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG5316
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
HNT3
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
aptx
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 60,593,338 - 60,618,946 (-) NCBI GRCr8 mRatBN7.2 5 55,798,896 - 55,822,963 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 55,800,248 - 55,822,855 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 57,767,534 - 57,788,467 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 59,586,691 - 59,607,626 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 59,580,671 - 59,601,669 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 56,987,714 - 57,009,481 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 56,987,909 - 57,008,859 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 61,521,843 - 61,543,083 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 58,060,210 - 58,081,165 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 58,060,392 - 58,081,344 (-) NCBI Celera 5 54,414,271 - 54,435,214 (-) NCBI Celera Cytogenetic Map 5 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Aptx Rat (1->4)-beta-D-glucan multiple interactions ISO Aptx (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of APTX mRNA CTD PMID:36331819 Aptx Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Aptx (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Aptx Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Aptx (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of APTX mRNA CTD PMID:21570461 Aptx Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of APTX mRNA CTD PMID:33387578 Aptx Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Aptx (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of APTX mRNA CTD PMID:15328365 and PMID:23994337 Aptx Rat 2-methylcholine affects expression ISO APTX (Homo sapiens) 6480464 beta-methylcholine affects the expression of APTX mRNA CTD PMID:21179406 Aptx Rat 3,3',4,4',5-pentachlorobiphenyl increases expression ISO Aptx (Mus musculus) 6480464 3 more ... CTD PMID:23994337 Aptx Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Aptx (Mus musculus) 6480464 3 more ... CTD PMID:19467301 Aptx Rat 4,4'-diaminodiphenylmethane decreases expression ISO Aptx (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of APTX mRNA CTD PMID:18648102 Aptx Rat 4,4'-sulfonyldiphenol increases expression ISO Aptx (Mus musculus) 6480464 bisphenol S results in increased expression of APTX mRNA CTD PMID:39298647 Aptx Rat acrolein multiple interactions ISO APTX (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of APTX mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of APTX mRNA CTD PMID:32699268 Aptx Rat acrylamide increases expression ISO APTX (Homo sapiens) 6480464 Acrylamide results in increased expression of APTX mRNA CTD PMID:32763439 Aptx Rat aflatoxin B1 increases methylation ISO APTX (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of APTX intron CTD PMID:30157460 Aptx Rat all-trans-retinoic acid decreases expression ISO APTX (Homo sapiens) 6480464 Tretinoin results in decreased expression of APTX mRNA CTD PMID:33167477 Aptx Rat alpha-pinene multiple interactions ISO APTX (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of APTX mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of APTX mRNA CTD PMID:32699268 Aptx Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of APTX mRNA CTD PMID:16483693 Aptx Rat antirheumatic drug decreases expression ISO APTX (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of APTX mRNA CTD PMID:24449571 Aptx Rat aristolochic acid A increases expression ISO APTX (Homo sapiens) 6480464 aristolochic acid I results in increased expression of APTX mRNA CTD PMID:33212167 Aptx Rat arsenite(3-) multiple interactions ISO APTX (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to APTX mRNA] CTD PMID:32406909 Aptx Rat arsenous acid multiple interactions ISO APTX (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to APTX protein] CTD PMID:26598702 Aptx Rat benzo[a]pyrene increases expression ISO Aptx (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of APTX mRNA CTD PMID:22228805 Aptx Rat benzo[a]pyrene decreases methylation ISO APTX (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of APTX 5' UTR and Benzo(a)pyrene results in decreased methylation of APTX promoter CTD PMID:27901495 Aptx Rat benzo[a]pyrene diol epoxide I decreases expression ISO APTX (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Aptx Rat beta-lapachone increases expression ISO APTX (Homo sapiens) 6480464 beta-lapachone results in increased expression of APTX mRNA CTD PMID:38218311 Aptx Rat beta-naphthoflavone increases expression ISO Aptx (Mus musculus) 6480464 beta-Naphthoflavone results in increased expression of APTX mRNA CTD PMID:23994337 Aptx Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of APTX mRNA CTD PMID:25181051 Aptx Rat bromobenzene decreases expression EXP 6480464 bromobenzene results in decreased expression of APTX mRNA CTD PMID:32479839 Aptx Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of APTX promoter CTD PMID:22457795 Aptx Rat cadmium dichloride increases expression ISO APTX (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of APTX mRNA CTD PMID:26472689 Aptx Rat carbon nanotube decreases expression ISO Aptx (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Aptx Rat CGP 52608 multiple interactions ISO APTX (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to APTX gene] CTD PMID:28238834 Aptx Rat chlorpyrifos decreases expression ISO Aptx (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of APTX mRNA CTD PMID:37019170 Aptx Rat cisplatin increases expression ISO APTX (Homo sapiens) 6480464 Cisplatin results in increased expression of APTX mRNA CTD PMID:27392435 Aptx Rat diarsenic trioxide multiple interactions ISO APTX (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to APTX protein] CTD PMID:26598702 Aptx Rat Dibutyl phosphate affects expression ISO APTX (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of APTX mRNA CTD PMID:37042841 Aptx Rat dicrotophos decreases expression ISO APTX (Homo sapiens) 6480464 dicrotophos results in decreased expression of APTX mRNA CTD PMID:28302478 Aptx Rat dioxygen multiple interactions ISO Aptx (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of APTX mRNA CTD PMID:30529165 Aptx Rat ethyl methanesulfonate increases expression ISO APTX (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of APTX mRNA CTD PMID:23649840 Aptx Rat FR900359 affects phosphorylation ISO APTX (Homo sapiens) 6480464 FR900359 affects the phosphorylation of APTX protein CTD PMID:37730182 Aptx Rat glyphosate affects methylation EXP 6480464 Glyphosate affects the methylation of APTX gene CTD PMID:35440735 Aptx Rat hydroquinone O-beta-D-glucopyranoside decreases expression ISO APTX (Homo sapiens) 6480464 Arbutin results in decreased expression of APTX mRNA CTD PMID:17103032 Aptx Rat kojic acid decreases expression ISO APTX (Homo sapiens) 6480464 kojic acid results in decreased expression of APTX mRNA CTD PMID:16595896 Aptx Rat methotrexate decreases expression ISO APTX (Homo sapiens) 6480464 Methotrexate results in decreased expression of APTX mRNA CTD PMID:24449571 Aptx Rat methyl methanesulfonate increases expression ISO APTX (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of APTX mRNA CTD PMID:23649840 Aptx Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of APTX mRNA CTD PMID:23358140 Aptx Rat ozone multiple interactions ISO APTX (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of APTX mRNA more ... CTD PMID:32699268 Aptx Rat paracetamol affects expression ISO Aptx (Mus musculus) 6480464 Acetaminophen affects the expression of APTX mRNA CTD PMID:17562736 Aptx Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of APTX mRNA CTD PMID:33387578 Aptx Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Aptx (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of APTX mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of APTX mRNA CTD PMID:36331819 Aptx Rat pirinixic acid increases expression ISO Aptx (Mus musculus) 6480464 pirinixic acid results in increased expression of APTX mRNA CTD PMID:18301758 more ... Aptx Rat resveratrol multiple interactions ISO APTX (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of APTX mRNA CTD PMID:23557933 Aptx Rat titanium dioxide decreases methylation ISO Aptx (Mus musculus) 6480464 titanium dioxide results in decreased methylation of APTX promoter CTD PMID:35295148 Aptx Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of APTX gene CTD PMID:27618143 Aptx Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of APTX mRNA CTD PMID:33387578 Aptx Rat valproic acid increases expression ISO APTX (Homo sapiens) 6480464 Valproic Acid results in increased expression of APTX mRNA CTD PMID:29154799
(1->4)-beta-D-glucan (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-methylcholine (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,3',4,4'-tetrachlorobiphenyl (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) acrolein (ISO) acrylamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) beta-naphthoflavone (ISO) bisphenol A (EXP) bromobenzene (EXP) cadmium dichloride (EXP,ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) cisplatin (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) dioxygen (ISO) ethyl methanesulfonate (ISO) FR900359 (ISO) glyphosate (EXP) hydroquinone O-beta-D-glucopyranoside (ISO) kojic acid (ISO) methotrexate (ISO) methyl methanesulfonate (ISO) ochratoxin A (EXP) ozone (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) pirinixic acid (ISO) resveratrol (ISO) titanium dioxide (ISO) trichloroethene (EXP) valproic acid (ISO)
1.
Ataxia with oculomotor apraxia type1 (AOA1): novel and recurrent aprataxin mutations, coenzyme Q10 analyses, and clinical findings in Italian patients.
Castellotti B, etal., Neurogenetics. 2011 Aug;12(3):193-201. doi: 10.1007/s10048-011-0281-x. Epub 2011 Apr 5.
2.
A novel mutation of aprataxin associated with ataxia ocular apraxia type 1: phenotypical and genotypical characterization.
Ferrarini M, etal., J Neurol Sci. 2007 Sep 15;260(1-2):219-24. Epub 2007 Jun 18.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
The mechanism of double-strand DNA break repair by the nonhomologous DNA end-joining pathway.
Lieber MR Annu Rev Biochem. 2010;79:181-211. doi: 10.1146/annurev.biochem.052308.093131.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
The gene mutated in ataxia-ocular apraxia 1 encodes the new HIT/Zn-finger protein aprataxin.
Moreira MC, etal., Nat Genet 2001 Oct;29(2):189-93.
7.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
8.
GOA pipeline
RGD automated data pipeline
9.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Comprehensive gene review and curation
RGD comprehensive gene curation
12.
Early-onset ataxia with ocular motor apraxia and hypoalbuminemia: the aprataxin gene mutations.
Shimazaki H, etal., Neurology. 2002 Aug 27;59(4):590-5.
13.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Aptx Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 60,593,338 - 60,618,946 (-) NCBI GRCr8 mRatBN7.2 5 55,798,896 - 55,822,963 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 55,800,248 - 55,822,855 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 57,767,534 - 57,788,467 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 59,586,691 - 59,607,626 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 59,580,671 - 59,601,669 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 56,987,714 - 57,009,481 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 56,987,909 - 57,008,859 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 61,521,843 - 61,543,083 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 58,060,210 - 58,081,165 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 58,060,392 - 58,081,344 (-) NCBI Celera 5 54,414,271 - 54,435,214 (-) NCBI Celera Cytogenetic Map 5 q22 NCBI
APTX Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 32,972,616 - 33,025,120 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 32,886,601 - 33,025,130 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 32,972,614 - 33,025,118 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 32,962,608 - 32,991,626 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 9 32,903,909 - 32,932,925 (-) NCBI Celera Cytogenetic Map 9 p21.1 NCBI HuRef 9 32,930,986 - 32,960,001 (-) NCBI HuRef CHM1_1 9 32,972,285 - 33,001,325 (-) NCBI CHM1_1 T2T-CHM13v2.0 9 32,989,181 - 33,041,681 (-) NCBI T2T-CHM13v2.0
Aptx Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 40,682,078 - 40,703,206 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 40,682,382 - 40,703,194 (-) Ensembl GRCm39 Ensembl GRCm38 4 40,682,078 - 40,721,667 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 40,682,382 - 40,703,194 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 40,629,111 - 40,650,220 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 40,871,049 - 40,891,858 (-) NCBI MGSCv36 mm8 Celera 4 40,342,394 - 40,363,460 (-) NCBI Celera Cytogenetic Map 4 A5 NCBI cM Map 4 20.46 NCBI
Aptx Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955472 2,652,869 - 2,664,272 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955472 2,645,716 - 2,664,394 (+) NCBI ChiLan1.0 ChiLan1.0
APTX Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 91,562,555 - 91,634,457 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 91,611,331 - 91,640,405 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 32,747,409 - 32,819,270 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 33,556,419 - 33,608,416 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 33,556,419 - 33,585,060 (-) Ensembl panpan1.1 panPan2
APTX Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 11 50,111,003 - 50,155,937 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 11 50,113,073 - 50,132,284 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 11 48,741,830 - 48,752,689 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 11 51,051,842 - 51,096,541 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 11 51,052,518 - 51,072,916 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 11 49,716,952 - 49,727,812 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 11 49,583,853 - 49,594,717 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 11 50,348,839 - 50,359,700 (-) NCBI UU_Cfam_GSD_1.0
Aptx Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 165,022,018 - 165,052,707 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936524 1,570,627 - 1,576,329 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936524 1,569,610 - 1,582,103 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
APTX Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 10 33,445,148 - 33,543,710 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 10 33,470,089 - 33,495,584 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 10 37,724,516 - 37,837,919 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
APTX Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 47,239,094 - 47,346,528 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 47,258,798 - 47,287,102 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 44,140,910 - 44,239,181 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Aptx
.
Predicted Target Of
Count of predictions: 50 Count of miRNA genes: 47 Interacting mature miRNAs: 50 Transcripts: ENSRNOT00000046463 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1578776 Stresp18 Stress response QTL 18 2.9 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 5 27955440 72955440 Rat 1298067 Scl15 Serum cholesterol level QTL 15 4.8 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 33215665 78215665 Rat 1300115 Hrtrt7 Heart rate QTL 7 2.76 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 5 47869062 90099692 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 1358353 Srcrtb2 Stress Responsive Cort Basal QTL 2 3.48 0.003 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 18873947 74251464 Rat 634305 Mamtr1 Mammary tumor resistance QTL 1 0.0001 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 12789751 113558310 Rat 1331801 Rf33 Renal function QTL 33 4.149 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 43726656 129132602 Rat 1598807 Glom12 Glomerulus QTL 12 2.7 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 5 33215665 78215665 Rat 1302786 Kidm8 Kidney mass QTL 8 28.15 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 5 33215665 78215665 Rat 6903292 Stl28 Serum triglyceride level QTL 28 2.6 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 5 28515489 73515489 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 1578767 Stresp17 Stress response QTL 17 4.3 0.01 blood aldosterone amount (VT:0005346) plasma aldosterone level (CMO:0000551) 5 27955440 72955440 Rat 7411561 Bw134 Body weight QTL 134 24 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 49463600 94463600 Rat 1641922 Alcrsp8 Alcohol response QTL 8 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 5 35189153 68564008 Rat 2303615 Vencon7 Ventilatory control QTL 7 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 5 50983895 95983895 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 6903306 Scl35 Serum cholesterol QTL 35 2.6 0.0073 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 28515489 73515489 Rat 1576317 Eutr2 Estrogen induced uterine response QTL 2 0.01 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 34730116 104251008 Rat 7394712 Emca13 Estrogen-induced mammary cancer QTL 13 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 9823266 99753708 Rat 1331773 Scl26 Serum cholesterol level QTL 26 3.065 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 43726656 86724018 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 1331771 Rf35 Renal function QTL 35 4.36965 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 729470 86724018 Rat 61359 Eaex Experimental allergic encephalomyelitis QTL x 3 nervous system integrity trait (VT:0010566) post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422) 5 55715622 100715622 Rat 8662454 Vetf3 Vascular elastic tissue fragility QTL 3 27.4 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 5 2282226 69540447 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 9589025 Epfw7 Epididymal fat weight QTL 7 20.66 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 5 49463600 94463600 Rat 2303574 Gluco42 Glucose level QTL 42 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 53496719 98496719 Rat 1641903 Alcrsp3 Alcohol response QTL 3 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 12689285 57689285 Rat 1331756 Rf34 Renal function QTL 34 4.16275 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 1 90450412 Rat 8552954 Pigfal14 Plasma insulin-like growth factor 1 level QTL 14 9 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 21226744 66226744 Rat 2316959 Gluco59 Glucose level QTL 59 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 34944474 113558310 Rat 1600358 Mamtr5 Mammary tumor resistance QTL 5 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 18873947 63873947 Rat
D5Mgh26
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 60,601,597 - 60,601,739 (+) Marker Load Pipeline mRatBN7.2 5 55,805,606 - 55,805,750 (+) MAPPER mRatBN7.2 Rnor_6.0 5 56,991,667 - 56,991,808 NCBI Rnor6.0 Rnor_5.0 5 61,525,796 - 61,525,937 UniSTS Rnor5.0 RGSC_v3.4 5 58,063,971 - 58,064,113 RGD RGSC3.4 RGSC_v3.4 5 58,063,972 - 58,064,113 UniSTS RGSC3.4 RGSC_v3.1 5 58,064,151 - 58,064,292 RGD Celera 5 54,418,033 - 54,418,174 UniSTS RH 3.4 Map 5 271.11 UniSTS RH 3.4 Map 5 271.11 RGD RH 2.0 Map 5 324.1 RGD Cytogenetic Map 5 q22 UniSTS
BE103017
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 55,801,665 - 55,801,826 (+) MAPPER mRatBN7.2 Rnor_6.0 5 56,987,732 - 56,987,892 NCBI Rnor6.0 Rnor_5.0 5 61,521,861 - 61,522,021 UniSTS Rnor5.0 RGSC_v3.4 5 58,060,037 - 58,060,197 UniSTS RGSC3.4 Celera 5 54,414,098 - 54,414,258 UniSTS RH 3.4 Map 5 270.71 UniSTS Cytogenetic Map 5 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000046463 ⟹ ENSRNOP00000046400
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 55,800,248 - 55,822,855 (-) Ensembl Rnor_6.0 Ensembl 5 56,987,909 - 57,008,859 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000090891 ⟹ ENSRNOP00000072443
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 55,800,248 - 55,815,681 (-) Ensembl Rnor_6.0 Ensembl 5 56,987,909 - 57,008,795 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000094147 ⟹ ENSRNOP00000094856
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 55,800,248 - 55,822,855 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000115715 ⟹ ENSRNOP00000094475
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 55,800,248 - 55,821,492 (-) Ensembl
RefSeq Acc Id:
NM_148889 ⟹ NP_683687
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 60,597,836 - 60,618,790 (-) NCBI mRatBN7.2 5 55,801,839 - 55,822,805 (-) NCBI Rnor_6.0 5 56,987,905 - 57,008,859 (-) NCBI Rnor_5.0 5 61,521,843 - 61,543,083 (-) NCBI RGSC_v3.4 5 58,060,210 - 58,081,165 (-) RGD Celera 5 54,414,271 - 54,435,214 (-) RGD
Sequence:
GCCTGCTTTCGTAGCTGGTTGGGTTAGAAGCCAGCAGGGGCGTTTGGCCGGGGCTGCTAACCCGGAGCGGATACCTTGAAGGTGGAGTTCGAGGTTTCCTTCTGGGTGGACCAAGCCCCACCCTTTCG
hide sequence
RefSeq Acc Id:
XM_006238027 ⟹ XP_006238089
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 60,593,338 - 60,618,658 (-) NCBI mRatBN7.2 5 55,798,896 - 55,822,855 (-) NCBI Rnor_6.0 5 56,987,714 - 57,009,479 (-) NCBI Rnor_5.0 5 61,521,843 - 61,543,083 (-) NCBI
Sequence:
CAGGGTTCCTCTGTCTCTCTCTTTAGTCTTTTTCTCCTTAGAGAAGGAAAGTGTAATTTGAACG
hide sequence
RefSeq Acc Id:
XM_006238028 ⟹ XP_006238090
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 60,593,338 - 60,618,946 (-) NCBI mRatBN7.2 5 55,798,896 - 55,822,963 (-) NCBI Rnor_6.0 5 56,987,714 - 57,009,480 (-) NCBI Rnor_5.0 5 61,521,843 - 61,543,083 (-) NCBI
Sequence:
GCAGGGTTCCTCTGTCTCTCTCTTTAGTCTTTTTCTCCTTAGAGAAGGAAAGTGTAATTTGAAC
hide sequence
RefSeq Acc Id:
XM_006238029 ⟹ XP_006238091
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 60,593,338 - 60,611,680 (-) NCBI mRatBN7.2 5 55,798,896 - 55,815,691 (-) NCBI Rnor_6.0 5 56,987,714 - 57,001,697 (-) NCBI Rnor_5.0 5 61,521,843 - 61,543,083 (-) NCBI
Sequence:
AGCGAATCAAACTTCCCCATTTAGAAGCTGTTGTGATTGGTCGAAGCCCGGAGACCAAGATCAC
hide sequence
RefSeq Acc Id:
XM_008763607 ⟹ XP_008761829
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 60,593,338 - 60,618,822 (-) NCBI mRatBN7.2 5 55,798,896 - 55,822,814 (-) NCBI Rnor_6.0 5 56,987,714 - 57,009,481 (-) NCBI
Sequence:
AGCAGGGTTCCTCTGTCTCTCTCTTTAGTCTTTTTCTCCTTAGAGAAGGAAAGTGTAATTTGAA
hide sequence
RefSeq Acc Id:
XM_017593171 ⟹ XP_017448660
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 60,593,338 - 60,618,840 (-) NCBI mRatBN7.2 5 55,798,896 - 55,822,814 (-) NCBI Rnor_6.0 5 56,987,714 - 57,003,882 (-) NCBI
Sequence:
ATGGTAACAATATTCTCATCTTTAAGAATATGATTTCTTTGATCTTCATTTCTGAATACAGCAA
hide sequence
RefSeq Acc Id:
NP_683687 ⟸ NM_148889
- UniProtKB:
Q8K4H4 (UniProtKB/Swiss-Prot), A6IIS0 (UniProtKB/TrEMBL), A0A8L2R5W7 (UniProtKB/TrEMBL)
- Sequence:
MRVCWLVRQDCWHQRIKLPHLEAVVIGRSPETKITDKKCSRQQVQLKAECNKRYVNVKQMGVNPTSIDEVVIGKDREMKLLPGQVLHMVNELYPYMVEFEEVAESPNVTQRKRKRPDCDSQEMEAEAG
hide sequence
RefSeq Acc Id:
XP_006238090 ⟸ XM_006238028
- Peptide Label:
isoform X2
- UniProtKB:
Q8K4H4 (UniProtKB/Swiss-Prot), A6IIS0 (UniProtKB/TrEMBL), A0A8L2R5W7 (UniProtKB/TrEMBL)
- Sequence:
MRVCWLVRQDCWHQRIKLPHLEAVVIGRSPETKITDKKCSRQQVQLKAECNKRYVNVKQMGVNPTSIDEVVIGKDREMKLLPGQVLHMVNELYPYMVEFEEVAESPNVTQRKRKRPDCDSQEMEAEAG
hide sequence
RefSeq Acc Id:
XP_006238089 ⟸ XM_006238027
- Peptide Label:
isoform X2
- UniProtKB:
Q8K4H4 (UniProtKB/Swiss-Prot), A6IIS0 (UniProtKB/TrEMBL), A0A8L2R5W7 (UniProtKB/TrEMBL)
- Sequence:
MRVCWLVRQDCWHQRIKLPHLEAVVIGRSPETKITDKKCSRQQVQLKAECNKRYVNVKQMGVNPTSIDEVVIGKDREMKLLPGQVLHMVNELYPYMVEFEEVAESPNVTQRKRKRPDCDSQEMEAEAG
hide sequence
RefSeq Acc Id:
XP_006238091 ⟸ XM_006238029
- Peptide Label:
isoform X3
- UniProtKB:
A0A8L2R5W7 (UniProtKB/TrEMBL)
- Sequence:
MGVNPTSIDEVVIGKDREMKLLPGQVLHMVNELYPYMVEFEEVAESPNVTQRKRKRPDCDSQEMEAEAGASPSQCSVSPKTGKHGAAKEESLGHWSQGLKISMKDPKMQVYKDDQVVVIKDKYPKARH
hide sequence
RefSeq Acc Id:
XP_008761829 ⟸ XM_008763607
- Peptide Label:
isoform X3
- UniProtKB:
A0A8L2R5W7 (UniProtKB/TrEMBL)
- Sequence:
MGVNPTSIDEVVIGKDREMKLLPGQVLHMVNELYPYMVEFEEVAESPNVTQRKRKRPDCDSQEM
hide sequence
RefSeq Acc Id:
XP_017448660 ⟸ XM_017593171
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6GL70 (UniProtKB/TrEMBL), A0A8L2R5W7 (UniProtKB/TrEMBL)
- Sequence:
MLLGQEARYPPRAKMRVCWLVRQDCWHQRIKLPHLEAVVIGRSPETKITDKKCSRQQVQLKAECNKRYVNVKQMGVNPTSIDEVVIGKDREMKLLPGQVLHMVNELYPYMVEFEEVAESPNVTQRKRK
hide sequence
Ensembl Acc Id:
ENSRNOP00000072443 ⟸ ENSRNOT00000090891
Ensembl Acc Id:
ENSRNOP00000046400 ⟸ ENSRNOT00000046463
Ensembl Acc Id:
ENSRNOP00000094475 ⟸ ENSRNOT00000115715
Ensembl Acc Id:
ENSRNOP00000094856 ⟸ ENSRNOT00000094147
RGD ID: 13693633 Promoter ID: EPDNEW_R4158 Type: initiation region Name: Aptx_1 Description: aprataxin SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 57,008,909 - 57,008,969 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Aptx
aprataxin
Symbol and Name status set to approved
1299863 APPROVED
2003-02-27
Aptx
aprataxin
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_disease
mutations in the human homolog have been identified in patients with an early-onset ataxia with ocular motor apraxia and hypoalbuminemia
634558
